Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686502
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RPL31
Proper citation: Atlas Antibodies Cat# HPA072263, RRID:AB_2686502 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602892
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC19A1
Proper citation: Atlas Antibodies Cat# HPA024802, RRID:AB_10602892 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686345
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AXDND1
Proper citation: Atlas Antibodies Cat# HPA071114, RRID:AB_2686345 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079586
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PDCD4
Proper citation: Atlas Antibodies Cat# HPA001032, RRID:AB_1079586 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685339
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): PCSK1N
Proper citation: Sigma-Aldrich Cat# HPA064734, RRID:AB_2685339 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603556
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CAPZB
Proper citation: Atlas Antibodies Cat# HPA031531, RRID:AB_10603556 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2091341
Comments: Applications: Immunohistochemistry, ELISA Capture (Matched Antibody Pair)
Host Organism: Mouse
Clonality monoclonal
Target(s): Dkk-1
Proper citation: R and D Systems Cat# MAB10962, RRID:AB_2091341 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858966
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EDDDDDTEDFADQENLPDPQDISCHQSPSKTDHLTEKAYSDTPRDFPDSFQAGSPGHLGVIRDFSIESLLRENLYPKANIPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKNRKIK; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZBTB7C
Proper citation: Atlas Antibodies Cat# HPA014433, RRID:AB_1858966 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856041
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human RAD9A
Proper citation: Sigma-Aldrich Cat# HPA006725, RRID:AB_1856041 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_563797
Comments: Used By NYUIHC-67
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Keratin prepared from rat keritinocytes
Proper citation: Leica Biosystems Cat# NCL-CK17, RRID:AB_563797 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335656
Comments: Used By NYUIHC-986
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality monoclonal
Target(s): ND
Proper citation: Cell Marque Cat# 760-4282, RRID:AB_2335656 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669751
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC107 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA016857, RRID:AB_10669751 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673504
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ASF1A
Proper citation: Atlas Antibodies Cat# HPA030502, RRID:AB_2673504 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682409
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): CDSN
Proper citation: Sigma-Aldrich Cat# HPA054184, RRID:AB_2682409 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683310
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OXLD1
Proper citation: Atlas Antibodies Cat# HPA057019, RRID:AB_2683310 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679735
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FLVCR1
Proper citation: Atlas Antibodies Cat# HPA046646, RRID:AB_2679735 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680372
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RAB33B
Proper citation: Atlas Antibodies Cat# HPA048367, RRID:AB_2680372 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675977
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): NADK2
Proper citation: Atlas Antibodies Cat# HPA038366, RRID:AB_2675977 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683773
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): CMPK1
Proper citation: Sigma-Aldrich Cat# HPA058604, RRID:AB_2683773 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849939
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GPSM2
Proper citation: Atlas Antibodies Cat# HPA008408, RRID:AB_1849939 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.