Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 230 showing 4581 ~ 4600 out of 55,392 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681447

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LRRC4C

Proper citation: Atlas Antibodies Cat# HPA051335, RRID:AB_2681447 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794391

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM129C

Proper citation: Atlas Antibodies Cat# HPA043277, RRID:AB_10794391 Copy   

    • RRID:AB_2683155

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683155

Comments: Originating manufacturer of this product. Applications: WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SLC17A9

Proper citation: Atlas Antibodies Cat# HPA056499, RRID:AB_2683155 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2676920

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPVAHIRPLPTTVQAASPLPEEPPVPRPPPGFQASVPREASARVVVPIAPTCRSLESSPHSLVPMGPGREHLEEPPMAGPAAEAERVSSPAWASSPTPPSGPHPCPVPKVAPKP; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): PRR33

Proper citation: Atlas Antibodies Cat# HPA040293, RRID:AB_2676920 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680393

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ARL2BP

Proper citation: Atlas Antibodies Cat# HPA048440, RRID:AB_2680393 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10600864

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CPT1B

Proper citation: Atlas Antibodies Cat# HPA029583, RRID:AB_10600864 Copy   

    • RRID:AB_1079170

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079170

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): KCNE4

Proper citation: Atlas Antibodies Cat# HPA011420, RRID:AB_1079170 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2674596

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RASA2

Proper citation: Atlas Antibodies Cat# HPA035375, RRID:AB_2674596 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602020

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LCA5

Proper citation: Atlas Antibodies Cat# HPA029053, RRID:AB_10602020 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684927

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MYL3

Proper citation: Atlas Antibodies Cat# HPA063034, RRID:AB_2684927 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682274

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OR7A5

Proper citation: Atlas Antibodies Cat# HPA053823, RRID:AB_2682274 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680756

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LILRA4

Proper citation: Atlas Antibodies Cat# HPA049418, RRID:AB_2680756 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686350

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLCO1A2

Proper citation: Atlas Antibodies Cat# HPA071152, RRID:AB_2686350 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679596

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPYEKKFDTFIPLEPLPQIPNLPFWVKEKANSLKNEIQEVEELDNWQPAVPLMHMLHLSGALDF; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): SPATS1

Proper citation: Atlas Antibodies Cat# HPA046230, RRID:AB_2679596 Copy   

    • RRID:AB_2732585

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2732585

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): COG3

Proper citation: Atlas Antibodies Cat# HPA054470, RRID:AB_2732585 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2675142

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AASDH

Proper citation: Atlas Antibodies Cat# HPA036472, RRID:AB_2675142 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683526

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): P2RX3

Proper citation: Atlas Antibodies Cat# HPA057776, RRID:AB_2683526 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681264

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TYR

Proper citation: Atlas Antibodies Cat# HPA050889, RRID:AB_2681264 Copy   

    • RRID:AB_420957

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_420957

Comments: Discontinued; Applications: IP (1-5 µg/mg lysate), WB (1:10,000-1:20,000), IHC (1:500-1:2,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): EWS

Proper citation: Thermo Fisher Scientific Cat# A300-417A, RRID:AB_420957 Copy   

    • RRID:AB_2615140

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2615140

Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC10188 for not specified; status is not pursued; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_10640246, AB_2615140.
Host Organism: rabbit
Clonality unknown
Target(s): HNRNPU

Proper citation: Aviva Systems Biology Cat# ARP40519_P050, RRID:AB_2615140 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch