Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-LRRC4C polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA051335, RRID:AB_2681447 | LRRC4C | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2681447 | Atlas Antibodies | HPA051335 | 2025-08-20 01:33:04 | 0 | ||
|
Anti-FAM129C polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA043277, RRID:AB_10794391 | FAM129C | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10794391 | Atlas Antibodies | HPA043277 | 2025-08-20 01:33:04 | 0 | ||
|
Anti-SLC17A9 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA056499, RRID:AB_2683155 | SLC17A9 | human | Originating manufacturer of this product. Applications: WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2683155 | Atlas Antibodies | HPA056499 | 2025-08-20 01:32:27 | 0 | ||
|
Anti-PRR33 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA040293, RRID:AB_2676920 | PRR33 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPVAHIRPLPTTVQAASPLPEEPPVPRPPPGFQASVPREASARVVVPIAPTCRSLESSPHSLVPMGPGREHLEEPPMAGPAAEAERVSSPAWASSPTPPSGPHPCPVPKVAPKP; Manufacturer approved use: IHC | polyclonal | rabbit | AB_2676920 | Atlas Antibodies | HPA040293 | 2025-08-20 01:33:03 | 0 | ||
|
Anti-ARL2BP polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048440, RRID:AB_2680393 | ARL2BP | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680393 | Atlas Antibodies | HPA048440 | 2025-08-20 01:32:27 | 0 | ||
|
Anti-CPT1B polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA029583, RRID:AB_10600864 | CPT1B | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10600864 | Atlas Antibodies | HPA029583 | 2025-08-20 01:32:26 | 0 | ||
|
Anti-KCNE4 Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA011420, RRID:AB_1079170 | KCNE4 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1079170 | Atlas Antibodies | HPA011420 | 2025-08-20 01:33:03 | 1 | ||
|
Anti-RASA2 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA035375, RRID:AB_2674596 | RASA2 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2674596 | Atlas Antibodies | HPA035375 | 2025-08-20 01:33:03 | 1 | ||
|
Anti-LCA5 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA029053, RRID:AB_10602020 | LCA5 | Human, Rat, Mouse | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10602020 | Atlas Antibodies | HPA029053 | 2025-08-20 01:33:03 | 0 | ||
|
Anti-MYL3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA063034, RRID:AB_2684927 | MYL3 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2684927 | Atlas Antibodies | HPA063034 | 2025-08-20 01:33:04 | 0 | ||
|
Anti-OR7A5 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA053823, RRID:AB_2682274 | OR7A5 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682274 | Atlas Antibodies | HPA053823 | 2025-08-20 01:33:22 | 0 | ||
|
Anti-LILRA4 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA049418, RRID:AB_2680756 | LILRA4 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680756 | Atlas Antibodies | HPA049418 | 2025-08-20 01:33:22 | 0 | ||
|
Anti-SLCO1A2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA071152, RRID:AB_2686350 | SLCO1A2 | human | Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2686350 | Atlas Antibodies | HPA071152 | 2025-08-20 01:32:43 | 0 | ||
|
Anti-SPATS1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA046230, RRID:AB_2679596 | SPATS1 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPYEKKFDTFIPLEPLPQIPNLPFWVKEKANSLKNEIQEVEELDNWQPAVPLMHMLHLSGALDF; Manufacturer approved use: IHC | polyclonal | rabbit | AB_2679596 | Atlas Antibodies | HPA046230 | 2025-08-20 01:33:22 | 0 | ||
|
Anti-COG3 Antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA054470, RRID:AB_2732585 | COG3 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2732585 | Atlas Antibodies | HPA054470 | 2025-08-20 01:32:45 | 0 | ||
|
Anti-AASDH polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA036472, RRID:AB_2675142 | AASDH | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2675142 | Atlas Antibodies | HPA036472 | 2025-08-20 01:33:21 | 0 | ||
|
Anti-P2RX3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA057776, RRID:AB_2683526 | P2RX3 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2683526 | Atlas Antibodies | HPA057776 | 2025-08-20 01:32:43 | 0 | ||
|
Anti-TYR polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA050889, RRID:AB_2681264 | TYR | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2681264 | Atlas Antibodies | HPA050889 | 2025-08-20 01:32:42 | 0 | ||
|
EWS Antibody Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Thermo Fisher Scientific Cat# A300-417A, RRID:AB_420957 | EWS | human | Discontinued; Applications: IP (1-5 µg/mg lysate), WB (1:10,000-1:20,000), IHC (1:500-1:2,000) | polyclonal | rabbit | AB_420957 | Thermo Fisher Scientific | A300-417A | 2025-08-20 01:32:45 | 1 | ||
|
HNRNPU-human Resource Report Resource Website Rating or validation data |
Aviva Systems Biology Cat# ARP40519_P050, RRID:AB_2615140 | HNRNPU | Homo sapiens | ENCODE PROJECT External validation DATA SET is released testing lot QC10188 for not specified; status is not pursued; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_10640246, AB_2615140. | unknown | rabbit | AB_2615140 | Aviva Systems Biology | ARP40519_P050 (also ENCAB000AWF) | 2025-08-20 01:33:21 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
