Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-LGALS7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001549, RRID:AB_1078938 LGALS7 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078938 Atlas Antibodies HPA001549 2025-08-20 01:32:42 0
Anti-KIF26B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028478, RRID:AB_10601231 KIF26B human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601231 Atlas Antibodies HPA028478 2025-08-20 01:33:21 0
Anti-FUCA1
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA046542, RRID:AB_2679691 FUCA1 human Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE unknown rabbit AB_2679691 Sigma-Aldrich HPA046542 2025-08-20 01:33:23 0
Anti-PRDM12 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA043143, RRID:AB_10806379 PRDM12 mouse, human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10806379 Atlas Antibodies HPA043143 2025-08-20 01:33:21 2
Anti-CES1
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA046717, RRID:AB_2679770 CES1 human unknown rabbit AB_2679770 Sigma-Aldrich HPA046717 2025-08-20 01:33:23 0
Anti-DIXDC1
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA039658, RRID:AB_2676611 DIXDC1 human unknown rabbit AB_2676611 Sigma-Aldrich HPA039658 2025-08-20 01:32:43 0
Anti-PSME1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA006632, RRID:AB_1079686 PSME1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079686 Atlas Antibodies HPA006632 2025-08-20 01:33:21 0
Rabbit Anti-Human TNS3, Unconjugated
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA005547, RRID:AB_1080322 TNS3 human unknown rabbit AB_1080322 Atlas Antibodies HPA005547 2025-08-20 01:32:48 0
Anti-SLC7A3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA003629, RRID:AB_2190964 SLC7A3 human Vendor recommendations: unknown rabbit AB_2190964 Sigma-Aldrich HPA003629 2025-08-20 01:32:55 0
Anti-SLC16A2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA072719, RRID:AB_2686552 SLC16A2 mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686552 Atlas Antibodies HPA072719 2025-08-20 01:11:32 0
Anti-CARD16 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA062805, RRID:AB_2684871 CARD16 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AQRIWKQKLQRCHVQNTIIKWSERYTSGSF; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2684871 Atlas Antibodies HPA062805 2025-08-20 01:11:32 0
Anti-C15orf59 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041563, RRID:AB_10794670 C15orf59 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794670 Atlas Antibodies HPA041563 2025-08-20 01:11:32 0
Anti-ISCA2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030492, RRID:AB_10603772 ISCA2 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10603772 Atlas Antibodies HPA030492 2025-08-20 01:11:31 0
Anti-BUD13
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038341, RRID:AB_10671528 BUD13 mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10671528 Atlas Antibodies HPA038341 2025-08-20 01:11:32 0
Anti-KRT14 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA023040, RRID:AB_1852201 KRT14 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1852201 Atlas Antibodies HPA023040 2025-08-20 01:11:31 0
Anti-EPYC
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038212, RRID:AB_10672739 EPYC human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10672739 Atlas Antibodies HPA038212 2025-08-20 01:11:31 0
Anti-NIFK
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035736, RRID:AB_2674759 NIFK human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2674759 Atlas Antibodies HPA035736 2025-08-20 01:11:32 0
Anti-KIF2A polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA004716, RRID:AB_1079211 KIF2A Human, Rat Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079211 Atlas Antibodies HPA004716 2025-08-20 01:11:31 1
Anti-GRB2
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA030749, RRID:AB_2673590 GRB2 human unknown rabbit AB_2673590 Sigma-Aldrich HPA030749 2025-08-20 01:11:32 0
Anti-HARS polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036539, RRID:AB_10669796 HARS Human, Rat, Mouse Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10669796 Atlas Antibodies HPA036539 2025-08-20 01:11:31 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.