Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 233 showing 4641 ~ 4660 out of 55,392 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2335970

Comments: Used By NYUIHC-798
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND

Proper citation: Ventana Medical Systems Cat# 760-4464, RRID:AB_2335970 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080538

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNERMGPLNI; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): USP8

Proper citation: Atlas Antibodies Cat# HPA004869, RRID:AB_1080538 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602701

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): POMGNT2

Proper citation: Atlas Antibodies Cat# HPA034870, RRID:AB_10602701 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680839

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RBM15

Proper citation: Atlas Antibodies Cat# HPA049642, RRID:AB_2680839 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1853988

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): MLKL

Proper citation: Atlas Antibodies Cat# HPA010535, RRID:AB_1853988 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684101

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF420

Proper citation: Atlas Antibodies Cat# HPA059675, RRID:AB_2684101 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681178

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): JAG2

Proper citation: Atlas Antibodies Cat# HPA050567, RRID:AB_2681178 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078538

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CLPP

Proper citation: Atlas Antibodies Cat# HPA010649, RRID:AB_1078538 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684709

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HEATR1

Proper citation: Atlas Antibodies Cat# HPA062200, RRID:AB_2684709 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078123

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AKT1

Proper citation: Atlas Antibodies Cat# HPA002891, RRID:AB_1078123 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672521

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PPRC1

Proper citation: Atlas Antibodies Cat# HPA038511, RRID:AB_10672521 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672388

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GUCY2C

Proper citation: Atlas Antibodies Cat# HPA037655, RRID:AB_10672388 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680242

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NLRC3

Proper citation: Atlas Antibodies Cat# HPA048062, RRID:AB_2680242 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686250

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PMS2

Proper citation: Atlas Antibodies Cat# HPA070310, RRID:AB_2686250 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_259852

Comments: Applications: dot blot, immunohistochemistry (formalin-fixed, paraffin-embedded sections), radioimmunoassay
Host Organism: mouse
Clonality monoclonal
Target(s): Glucagon

Proper citation: Sigma-Aldrich Cat# G2654, RRID:AB_259852 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080657

Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): ZMAT5 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA004858, RRID:AB_1080657 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078865

Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human FGB

Proper citation: Sigma-Aldrich Cat# HPA001900, RRID:AB_1078865 Copy   

    • RRID:AB_1859046

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1859046

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ZBTB7B

Proper citation: Atlas Antibodies Cat# HPA006811, RRID:AB_1859046 Copy   

    • RRID:AB_310268

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_310268

Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: rabbit
Clonality polyclonal
Target(s): CREB1

Proper citation: Millipore Cat# 06-863, RRID:AB_310268 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601550

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ELOVL3

Proper citation: Atlas Antibodies Cat# HPA036236, RRID:AB_10601550 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch