Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
B-cell leukemia/lymphoma 2, bcl-2 Resource Report Resource Website Rating or validation data |
Ventana Medical Systems Cat# 760-4464, RRID:AB_2335970 | ND | [124] |
Used By NYUIHC-798 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_2335970 | Ventana Medical Systems | 760-4464 | 2025-08-20 12:49:34 | 0 | ||
|
Anti-USP8 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA004869, RRID:AB_1080538 | USP8 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNERMGPLNI; Manufacturer approved use: IHC, WB | polyclonal | rabbit | AB_1080538 | Atlas Antibodies | HPA004869 | 2025-08-20 12:49:43 | 0 | ||
|
Anti-POMGNT2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA034870, RRID:AB_10602701 | POMGNT2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10602701 | Atlas Antibodies | HPA034870 | 2025-08-20 12:49:56 | 0 | ||
|
Anti-RBM15 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA049642, RRID:AB_2680839 | RBM15 | human | Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680839 | Atlas Antibodies | HPA049642 | 2025-08-20 12:49:43 | 0 | ||
|
Anti-MLKL antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA010535, RRID:AB_1853988 | MLKL | human | polyclonal | rabbit | AB_1853988 | Atlas Antibodies | HPA010535 | 2025-08-20 12:49:45 | 0 | |||
|
Anti-ZNF420 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA059675, RRID:AB_2684101 | ZNF420 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2684101 | Atlas Antibodies | HPA059675 | 2025-08-20 12:49:43 | 0 | ||
|
Anti-JAG2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA050567, RRID:AB_2681178 | JAG2 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2681178 | Atlas Antibodies | HPA050567 | 2025-08-20 12:49:43 | 0 | ||
|
Anti-CLPP polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA010649, RRID:AB_1078538 | CLPP | Human, Rat, Mouse | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1078538 | Atlas Antibodies | HPA010649 | 2025-08-20 12:49:43 | 2 | ||
|
Anti-HEATR1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA062200, RRID:AB_2684709 | HEATR1 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2684709 | Atlas Antibodies | HPA062200 | 2025-08-20 12:49:43 | 0 | ||
|
Anti-AKT1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA002891, RRID:AB_1078123 | AKT1 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1078123 | Atlas Antibodies | HPA002891 | 2025-08-20 12:49:43 | 0 | ||
|
Anti-PPRC1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA038511, RRID:AB_10672521 | PPRC1 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10672521 | Atlas Antibodies | HPA038511 | 2025-08-20 12:49:43 | 0 | ||
|
Anti-GUCY2C polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA037655, RRID:AB_10672388 | GUCY2C | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10672388 | Atlas Antibodies | HPA037655 | 2025-08-20 12:49:43 | 0 | ||
|
Anti-NLRC3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048062, RRID:AB_2680242 | NLRC3 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680242 | Atlas Antibodies | HPA048062 | 2025-08-20 12:49:56 | 0 | ||
|
Anti-PMS2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA070310, RRID:AB_2686250 | PMS2 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2686250 | Atlas Antibodies | HPA070310 | 2025-08-20 12:49:43 | 0 | ||
|
Monoclonal Anti-Glucagon antibody produced in mouse Resource Report Resource Website 50+ mentions Rating or validation data |
Sigma-Aldrich Cat# G2654, RRID:AB_259852 | Glucagon | guinea pig, feline, rat, canine, pig, mouse, rabbit, human | K79bB10 | Applications: dot blot, immunohistochemistry (formalin-fixed, paraffin-embedded sections), radioimmunoassay | monoclonal | mouse | AB_259852 | Sigma-Aldrich | G2654 | 2025-08-20 12:50:16 | 96 | |
|
Anti-ZMAT5 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA004858, RRID:AB_1080657 | ZMAT5 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_1080657 | Sigma-Aldrich | HPA004858 | 2025-08-20 12:49:57 | 0 | ||
|
Anti-FGB antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA001900, RRID:AB_1078865 | Human FGB | human | Vendor recommendations: | unknown | rabbit | AB_1078865 | Sigma-Aldrich | HPA001900 | 2025-08-20 01:06:43 | 0 | ||
|
Anti-ZBTB7B Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006811, RRID:AB_1859046 | ZBTB7B | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1859046 | Atlas Antibodies | HPA006811 | 2025-08-20 01:06:39 | 0 | ||
|
CREB1-human Resource Report Resource Website 1+ mentions Rating or validation data |
Millipore Cat# 06-863, RRID:AB_310268 | CREB1 | homo sapiens | ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data | polyclonal | rabbit | AB_310268 | Millipore | 06-863 | 2025-08-20 01:06:37 | 2 | ||
|
Anti-ELOVL3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA036236, RRID:AB_10601550 | ELOVL3 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10601550 | Atlas Antibodies | HPA036236 | 2025-08-20 01:06:41 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
