Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683765
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SMTN
Proper citation: Atlas Antibodies Cat# HPA058590, RRID:AB_2683765 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670034
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): AMACR
Proper citation: Atlas Antibodies Cat# HPA020912, RRID:AB_10670034 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669550
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PTPN5
Proper citation: Atlas Antibodies Cat# HPA031014, RRID:AB_10669550 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079396
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): MMP3
Proper citation: Atlas Antibodies Cat# HPA007875, RRID:AB_1079396 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686051
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MMP11
Proper citation: Atlas Antibodies Cat# HPA068864, RRID:AB_2686051 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601335
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence REALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVIN; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): AS3MT
Proper citation: Atlas Antibodies Cat# HPA027708, RRID:AB_10601335 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_386092
Comments: Applications: WB, IP
Host Organism: rabbit
Clonality polyclonal
Target(s): Bcl11a
Proper citation: Bethyl Cat# A300-381A, RRID:AB_386092 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732260
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SLC22A6
Proper citation: Atlas Antibodies Cat# HPA074559, RRID:AB_2732260 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677985
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): NCBP1
Proper citation: Sigma-Aldrich Cat# HPA042411, RRID:AB_2677985 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681896
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): SERPINB1
Proper citation: Sigma-Aldrich Cat# HPA052642, RRID:AB_2681896 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682883
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZFR2
Proper citation: Atlas Antibodies Cat# HPA055678, RRID:AB_2682883 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677862
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF417
Proper citation: Atlas Antibodies Cat# HPA042125, RRID:AB_2677862 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686061
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): COQ10A
Proper citation: Atlas Antibodies Cat# HPA068931, RRID:AB_2686061 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1524109
Comments: Discontinued; Applications: IP (2-5 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): ZEB1
Proper citation: Thermo Fisher Scientific Cat# A301-921A, RRID:AB_1524109 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673142
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): ATG13 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA039350, RRID:AB_10673142 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_532261
Comments: Vendor recommendations: Immunoprecipitation; Western Blot; immunoblotting: 1:4,000-1:8,000
Host Organism: rabbit
Clonality polyclonal
Target(s): MAFF (N-terminal) antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# M8569, RRID:AB_532261 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079630
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): PLCXD1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA007721, RRID:AB_1079630 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602388
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): ARV1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA035708, RRID:AB_10602388 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670850
Comments: Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PSMD6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA036922, RRID:AB_10670850 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10618017
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40289 for K562; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): GPKOW
Proper citation: GeneTex Cat# GTX117716, RRID:AB_10618017 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
