Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_2527780
Comments: indirect ELISA: suitable
Host Organism: rabbit
Clonality unknown
Target(s): LGI4
Proper citation: Creative Diagnostics Cat# DPAB-L20677, RRID:AB_2527780 Copy
Discontinued
http://antibodyregistry.org/AB_2543596
Comments: Discontinued; Applications: Flow Cytometry (1:10-50), Immunohistochemistry (1:50-100), Western Blot (1:100-500); Reactive Species: Human
Host Organism: rabbit
Clonality polyclonal
Target(s): RPLP0
Proper citation: Thermo Fisher Scientific Cat# PA5-26096, RRID:AB_2543596 Copy
http://antibodyregistry.org/AB_2502400
Comments: WB
Host Organism: rabbit
Clonality unknown
Target(s):
Proper citation: Creative Diagnostics Cat# DPABH-24916, RRID:AB_2502400 Copy
http://antibodyregistry.org/AB_2797433
Comments: Applications: WB
Host Organism: rabbit
Clonality polyclonal
Target(s): CD123
Proper citation: Bioworld Technology Cat# AP0797, RRID:AB_2797433 Copy
http://antibodyregistry.org/AB_2885933
Comments: Applications: WB, IP
Host Organism: rabbit
Clonality polyclonal
Target(s): PMS1
Proper citation: GeneTex Cat# GTX129232, RRID:AB_2885933 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673360
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MICAL1
Proper citation: Atlas Antibodies Cat# HPA030176, RRID:AB_2673360 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686413
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ITGB1BP1
Proper citation: Atlas Antibodies Cat# HPA071538, RRID:AB_2686413 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078967
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GIT1
Proper citation: Atlas Antibodies Cat# HPA004186, RRID:AB_1078967 Copy
http://antibodyregistry.org/AB_2796194
Comments: Original manufacturer of this product; ISO 9001:2015
Host Organism: rabbit
Clonality unknown
Target(s): IgG(H+L)
Proper citation: SouthernBiotech Cat# 6140-01, RRID:AB_2796194 Copy
http://antibodyregistry.org/AB_2796084
Comments: Original manufacturer of this product; ISO 9001:2015
Host Organism: rabbit
Clonality unknown
Target(s): IgG(H+L)
Proper citation: SouthernBiotech Cat# 6000-04, RRID:AB_2796084 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682994
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RGLGTAMLRDFCETFPEDEALGVSCPMSPAMYQAHPGNSEDVSRHARTSQNDRPRQPAPGDGSKERMCGEELEDTKDDPEC; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM169B
Proper citation: Atlas Antibodies Cat# HPA055979, RRID:AB_2682994 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681369
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): METRN
Proper citation: Atlas Antibodies Cat# HPA051164, RRID:AB_2681369 Copy
Discontinued
http://antibodyregistry.org/AB_10893577
Comments: Discontinued; Applications: IHC (1:500-1:5,000), IP (2-10 µg/mg lysate)
Host Organism: rabbit
Clonality polyclonal
Target(s): HSF1
Proper citation: Thermo Fisher Scientific Cat# A303-174A, RRID:AB_10893577 Copy
Discontinued
http://antibodyregistry.org/AB_2662681
Comments: Discontinued: 2018; Vendor recommended applications: IF (1-4 ug/ml), ICC (1-4 ug/ml)
Host Organism: rabbit
Clonality polyclonal
Target(s): Tenascin X
Proper citation: Thermo Fisher Scientific Cat# PA5-67105, RRID:AB_2662681 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686280
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SPRY1
Proper citation: Atlas Antibodies Cat# HPA070554, RRID:AB_2686280 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682924
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PLOD1
Proper citation: Atlas Antibodies Cat# HPA055799, RRID:AB_2682924 Copy
http://antibodyregistry.org/AB_2864052
Comments: Applications: WB
Host Organism: rabbit
Clonality unknown
Target(s):
Proper citation: ABclonal Cat# AP1197, RRID:AB_2864052 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794269
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZSWIM8
Proper citation: Atlas Antibodies Cat# HPA041244, RRID:AB_10794269 Copy
http://antibodyregistry.org/AB_2885936
Comments: Applications: WB, ICC/IF, IP
Host Organism: rabbit
Clonality polyclonal
Target(s): TCF3
Proper citation: GeneTex Cat# GTX129237, RRID:AB_2885936 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685298
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMSB15B
Proper citation: Atlas Antibodies Cat# HPA064607, RRID:AB_2685298 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
