Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681345
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MINDY2
Proper citation: Atlas Antibodies Cat# HPA051103, RRID:AB_2681345 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681382
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TOR1A
Proper citation: Atlas Antibodies Cat# HPA051195, RRID:AB_2681382 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681319
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGKAADIPDSSLWENPDSAQANGIDSVLSRAEIASCSYEARQLGIKNGMFFGHAKQLCPNLQAVPYDFHAYKEVAQTLYETLASYTHNIEAVSCDEA; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): REV1
Proper citation: Atlas Antibodies Cat# HPA051036, RRID:AB_2681319 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681255
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PLAUR
Proper citation: Atlas Antibodies Cat# HPA050843, RRID:AB_2681255 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681173
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FMC1
Proper citation: Atlas Antibodies Cat# HPA050553, RRID:AB_2681173 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681184
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AMPD2
Proper citation: Atlas Antibodies Cat# HPA050590, RRID:AB_2681184 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681308
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF215
Proper citation: Atlas Antibodies Cat# HPA051010, RRID:AB_2681308 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681362
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CAMTA2
Proper citation: Atlas Antibodies Cat# HPA051147, RRID:AB_2681362 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681242
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATP10D
Proper citation: Atlas Antibodies Cat# HPA050808, RRID:AB_2681242 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681365
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): KANK3
Proper citation: Atlas Antibodies Cat# HPA051153, RRID:AB_2681365 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681279
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RNF170
Proper citation: Atlas Antibodies Cat# HPA050931, RRID:AB_2681279 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681354
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SH2B2
Proper citation: Atlas Antibodies Cat# HPA051131, RRID:AB_2681354 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681295
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPR12
Proper citation: Atlas Antibodies Cat# HPA050972, RRID:AB_2681295 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681261
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNFAIP6
Proper citation: Atlas Antibodies Cat# HPA050884, RRID:AB_2681261 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681387
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMOD1
Proper citation: Atlas Antibodies Cat# HPA051202, RRID:AB_2681387 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681192
Comments: Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): POU1F1
Proper citation: Atlas Antibodies Cat# HPA050624, RRID:AB_2681192 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681397
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPC24
Proper citation: Atlas Antibodies Cat# HPA051234, RRID:AB_2681397 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681214
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CASP2
Proper citation: Atlas Antibodies Cat# HPA050678, RRID:AB_2681214 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681378
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GINS1
Proper citation: Atlas Antibodies Cat# HPA051185, RRID:AB_2681378 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681363
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ART1
Proper citation: Atlas Antibodies Cat# HPA051148, RRID:AB_2681363 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.