Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Target Organism:human (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

2,504,750 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-MINDY2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051103, RRID:AB_2681345 MINDY2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681345 Atlas Antibodies HPA051103 2026-08-29 06:50:04 0
Anti-TOR1A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051195, RRID:AB_2681382 TOR1A human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681382 Atlas Antibodies HPA051195 2026-08-28 11:06:38 0
Anti-REV1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051036, RRID:AB_2681319 REV1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGKAADIPDSSLWENPDSAQANGIDSVLSRAEIASCSYEARQLGIKNGMFFGHAKQLCPNLQAVPYDFHAYKEVAQTLYETLASYTHNIEAVSCDEA; Manufacturer approved use: IHC polyclonal rabbit AB_2681319 Atlas Antibodies HPA051036 2026-08-31 12:29:14 0
Anti-PLAUR polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050843, RRID:AB_2681255 PLAUR human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681255 Atlas Antibodies HPA050843 2026-08-29 12:22:00 0
Anti-FMC1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050553, RRID:AB_2681173 FMC1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681173 Atlas Antibodies HPA050553 2026-08-29 08:50:22 0
Anti-AMPD2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050590, RRID:AB_2681184 AMPD2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681184 Atlas Antibodies HPA050590 2026-08-31 03:43:44 0
Anti-ZNF215 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051010, RRID:AB_2681308 ZNF215 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681308 Atlas Antibodies HPA051010 2026-08-31 08:22:15 0
Anti-CAMTA2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051147, RRID:AB_2681362 CAMTA2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681362 Atlas Antibodies HPA051147 2026-08-31 07:01:20 0
Anti-ATP10D polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050808, RRID:AB_2681242 ATP10D human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681242 Atlas Antibodies HPA050808 2026-08-28 06:35:19 0
Anti-KANK3
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051153, RRID:AB_2681365 KANK3 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2681365 Atlas Antibodies HPA051153 2026-08-31 09:38:47 0
Anti-RNF170 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050931, RRID:AB_2681279 RNF170 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681279 Atlas Antibodies HPA050931 2026-08-29 07:48:25 0
Anti-SH2B2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051131, RRID:AB_2681354 SH2B2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681354 Atlas Antibodies HPA051131 2026-08-31 10:26:18 0
Anti-GPR12 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050972, RRID:AB_2681295 GPR12 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681295 Atlas Antibodies HPA050972 2026-08-31 03:23:29 0
Anti-TNFAIP6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050884, RRID:AB_2681261 TNFAIP6 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681261 Atlas Antibodies HPA050884 2026-08-29 10:37:20 0
Anti-TMOD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051202, RRID:AB_2681387 TMOD1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681387 Atlas Antibodies HPA051202 2026-08-29 06:50:04 0
Anti-POU1F1
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA050624, RRID:AB_2681192 POU1F1 human Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2681192 Atlas Antibodies HPA050624 2026-08-29 08:18:24 1
Anti-SPC24 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051234, RRID:AB_2681397 SPC24 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681397 Atlas Antibodies HPA051234 2026-08-29 05:59:42 0
Anti-CASP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050678, RRID:AB_2681214 CASP2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681214 Atlas Antibodies HPA050678 2026-08-29 01:17:33 0
Anti-GINS1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051185, RRID:AB_2681378 GINS1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2681378 Atlas Antibodies HPA051185 2026-08-29 08:30:25 0
Anti-ART1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051148, RRID:AB_2681363 ART1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681363 Atlas Antibodies HPA051148 2026-08-31 04:32:35 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.