Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859538
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NYNRIN
Proper citation: Atlas Antibodies Cat# HPA018945, RRID:AB_1859538 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847220
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CREB1
Proper citation: Atlas Antibodies Cat# HPA019150, RRID:AB_1847220 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848241
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ERGIC1
Proper citation: Atlas Antibodies Cat# HPA018666, RRID:AB_1848241 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844854
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ANXA13
Proper citation: Atlas Antibodies Cat# HPA018535, RRID:AB_1844854 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856085
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RASAL2
Proper citation: Atlas Antibodies Cat# HPA018805, RRID:AB_1856085 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853665
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MCTP1
Proper citation: Atlas Antibodies Cat# HPA019018, RRID:AB_1853665 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849079
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): FOXK1
Proper citation: Atlas Antibodies Cat# HPA018864, RRID:AB_1849079 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2670037
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NEK3
Proper citation: Atlas Antibodies Cat# HPA019062, RRID:AB_2670037 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857165
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SLC43A1
Proper citation: Atlas Antibodies Cat# HPA018826, RRID:AB_1857165 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851667
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL17RE
Proper citation: Atlas Antibodies Cat# HPA019011, RRID:AB_1851667 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856059
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IPO7
Proper citation: Atlas Antibodies Cat# HPA019002, RRID:AB_1856059 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848282
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ETFB
Proper citation: Atlas Antibodies Cat# HPA018923, RRID:AB_1848282 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847827
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DOLPP1
Proper citation: Atlas Antibodies Cat# HPA019179, RRID:AB_1847827 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847070
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): COBL
Proper citation: Atlas Antibodies Cat# HPA019167, RRID:AB_1847070 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844656
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AHNAK
Proper citation: Atlas Antibodies Cat# HPA019070, RRID:AB_1844656 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855362
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PICALM
Proper citation: Atlas Antibodies Cat# HPA019061, RRID:AB_1855362 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845035
Comments: Applications: ICC-IF, IHC, protein array:, immunohistochemistry (formalin-fixed, paraffin-embedded sections)
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGSFRDSKSLTIQKDLVAAFDNGDQKVFFDLWEEHISSSIRD
Consolidation on 6/2023: AB_1233489
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARMC9
Proper citation: Atlas Antibodies Cat# HPA019041, RRID:AB_1845035 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845570
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM161B
Proper citation: Atlas Antibodies Cat# HPA019125, RRID:AB_1845570 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849672
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GIMAP4
Proper citation: Atlas Antibodies Cat# HPA019137, RRID:AB_1849672 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857443
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DGVFYDLDSCKHSSYPDSEGAPDSLWDWTVAPPVPATPYEAFDPAAAAFSHPQAAQLCYEPPTYSPAGNLELAPSLEAPGPGLPAYPTENFASQTLVPPAYAPYPSPVLSEEEDLPLDSPALEVSDSESDEALVA; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPIB
Proper citation: Atlas Antibodies Cat# HPA018523, RRID:AB_1857443 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.