Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Target Organism:human (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

2,504,750 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-ACAT2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA025736, RRID:AB_1844487 ACAT2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1844487 Atlas Antibodies HPA025736 2026-08-29 07:00:55 0
Anti-SH3GLB2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024734, RRID:AB_1856821 SH3GLB2 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1856821 Atlas Antibodies HPA024734 2026-08-31 01:41:30 0
Anti-REPS2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA026073, RRID:AB_1856176 REPS2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1856176 Atlas Antibodies HPA026073 2026-08-29 08:48:58 0
Anti-RBM6
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA026272, RRID:AB_1847592 RBM6 human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1847592 Atlas Antibodies HPA026272 2026-08-31 01:52:47 0
Anti-SERAC1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA025716, RRID:AB_2185128 SERAC1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2185128 Atlas Antibodies HPA025716 2026-08-31 08:42:42 0
Anti-TCF4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA025958, RRID:AB_1857849 TCF4 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1857849 Atlas Antibodies HPA025958 2026-08-29 05:01:18 0
Anti-ZNF830
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024754, RRID:AB_1859464 ZNF830 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1859464 Atlas Antibodies HPA024754 2026-08-28 05:24:02 0
Anti-KLHL38 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024770, RRID:AB_10599286 KLHL38 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10599286 Atlas Antibodies HPA024770 2026-08-29 07:42:25 0
Anti-ACSF2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024693, RRID:AB_2671654 ACSF2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2671654 Atlas Antibodies HPA024693 2026-08-31 05:15:21 0
Anti-GATM polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA026077, RRID:AB_1849528 GATM human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1849528 Atlas Antibodies HPA026077 2026-08-31 01:59:25 2
Anti-CRISPLD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024725, RRID:AB_1847238 CRISPLD1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1847238 Atlas Antibodies HPA024725 2026-08-28 06:02:21 0
Anti-ZNF677 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024796, RRID:AB_1859410 ZNF677 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1859410 Atlas Antibodies HPA024796 2026-08-29 10:01:28 0
Anti-RMDN1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA026495, RRID:AB_1848414 RMDN1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1848414 Atlas Antibodies HPA026495 2026-08-29 02:30:17 0
Anti-HDAC6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA026321, RRID:AB_1850546 HDAC6 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1850546 Atlas Antibodies HPA026321 2026-08-29 08:44:16 0
Anti-DARS2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA026528, RRID:AB_1847483 DARS2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1847483 Atlas Antibodies HPA026528 2026-08-31 03:57:15 0
Anti-PKDCC polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA026526, RRID:AB_10602416 PKDCC human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602416 Atlas Antibodies HPA026526 2026-08-31 12:31:52 0
Anti-WDYHV1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024823, RRID:AB_1845773 WDYHV1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1845773 Atlas Antibodies HPA024823 2026-08-28 06:33:24 0
Anti-AFMID polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA026536, RRID:AB_1844637 AFMID human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQVTRSVAFVQKRY; Manufacturer approved use: IHC, WB polyclonal rabbit AB_1844637 Atlas Antibodies HPA026536 2026-08-29 01:59:48 0
Anti-ARMC1
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA026085, RRID:AB_1845031 ARMC1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1845031 Atlas Antibodies HPA026085 2026-08-31 01:21:40 1
Anti-MUC15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA026110, RRID:AB_1854200 MUC15 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1854200 Atlas Antibodies HPA026110 2026-08-31 10:35:34 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.