Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078768
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EXD2
Proper citation: Atlas Antibodies Cat# HPA005848, RRID:AB_1078768 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667477
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDKN1A
Proper citation: Atlas Antibodies Cat# HPA005946, RRID:AB_2667477 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603239
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SERINC2
Proper citation: Atlas Antibodies Cat# HPA005974, RRID:AB_10603239 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855370
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PIGR
Proper citation: Atlas Antibodies Cat# HPA006154, RRID:AB_1855370 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080408
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TSG101
Proper citation: Atlas Antibodies Cat# HPA006161, RRID:AB_1080408 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079710
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PSMD8
Proper citation: Atlas Antibodies Cat# HPA006702, RRID:AB_1079710 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600782
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARMCX2
Proper citation: Atlas Antibodies Cat# HPA005761, RRID:AB_10600782 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080113
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): STON1
Proper citation: Atlas Antibodies Cat# HPA005715, RRID:AB_1080113 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667542
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EMX1
Proper citation: Atlas Antibodies Cat# HPA006230, RRID:AB_2667542 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078733
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ELF2
Proper citation: Atlas Antibodies Cat# HPA006057, RRID:AB_1078733 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854258
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MYOM2
Proper citation: Atlas Antibodies Cat# HPA005953, RRID:AB_1854258 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078339
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM189B
Proper citation: Atlas Antibodies Cat# HPA006659, RRID:AB_1078339 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667505
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): TACC3
Proper citation: Atlas Antibodies Cat# HPA006050, RRID:AB_2667505 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078446
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PTPRJ
Proper citation: Atlas Antibodies Cat# HPA006026, RRID:AB_1078446 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080683
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ZNF18
Proper citation: Atlas Antibodies Cat# HPA006144, RRID:AB_1080683 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079042
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HCFC2
Proper citation: Atlas Antibodies Cat# HPA006227, RRID:AB_1079042 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078735
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EMCN
Proper citation: Atlas Antibodies Cat# HPA005928, RRID:AB_1078735 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078875
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FKBP4
Proper citation: Atlas Antibodies Cat# HPA006148, RRID:AB_1078875 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600224
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZWINT
Proper citation: Atlas Antibodies Cat# HPA005757, RRID:AB_10600224 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078486
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDC42EP1
Proper citation: Atlas Antibodies Cat# HPA006379, RRID:AB_1078486 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.