Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669985
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SENP8
Proper citation: Atlas Antibodies Cat# HPA036273, RRID:AB_10669985 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669665
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FGF19
Proper citation: Atlas Antibodies Cat# HPA036082, RRID:AB_10669665 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669984
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GLS
Proper citation: Atlas Antibodies Cat# HPA036223, RRID:AB_10669984 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602355
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF385D
Proper citation: Atlas Antibodies Cat# HPA036190, RRID:AB_10602355 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674945
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TXNRD3
Proper citation: Atlas Antibodies Cat# HPA036109, RRID:AB_2674945 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673346
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EXOSC7
Proper citation: Atlas Antibodies Cat# HPA036182, RRID:AB_10673346 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670106
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SH3BP5
Proper citation: Atlas Antibodies Cat# HPA036445, RRID:AB_10670106 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673388
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PYURF
Proper citation: Atlas Antibodies Cat# HPA036455, RRID:AB_10673388 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675020
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM98A
Proper citation: Atlas Antibodies Cat# HPA036250, RRID:AB_2675020 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674988
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ACY1
Proper citation: Atlas Antibodies Cat# HPA036174, RRID:AB_2674988 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672999
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RNPEP
Proper citation: Atlas Antibodies Cat# HPA036075, RRID:AB_10672999 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674980
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): IMMT
Proper citation: Atlas Antibodies Cat# HPA036165, RRID:AB_2674980 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673126
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LARP1B
Proper citation: Atlas Antibodies Cat# HPA036280, RRID:AB_10673126 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673123
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATP11B
Proper citation: Atlas Antibodies Cat# HPA036237, RRID:AB_10673123 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675109
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FBXL17
Proper citation: Atlas Antibodies Cat# HPA036410, RRID:AB_2675109 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669787
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): HOMEZ
Proper citation: Atlas Antibodies Cat# HPA036317, RRID:AB_10669787 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673349
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): C6orf58
Proper citation: Atlas Antibodies Cat# HPA036263, RRID:AB_10673349 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675023
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEDLAGKVFVTSGLGGMSGAQAKAAVIVGCIG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): UROC1
Proper citation: Atlas Antibodies Cat# HPA036254, RRID:AB_2675023 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601916
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): IPCEF1
Proper citation: Atlas Antibodies Cat# HPA028708, RRID:AB_10601916 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603006
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ZNF354B
Proper citation: Atlas Antibodies Cat# HPA029056, RRID:AB_10603006 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
