Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 348 showing 6941 ~ 6960 out of 1,488,177 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

http://antibodyregistry.org/AB_2527780

Comments: indirect ELISA: suitable
Host Organism: rabbit
Clonality: unknown
Target(s): LGI4

Proper citation: Creative Diagnostics Cat# DPAB-L20677, RRID:AB_2527780 Copy   


  • RRID:AB_2543596

Discontinued

http://antibodyregistry.org/AB_2543596

Comments: Discontinued; Applications: Flow Cytometry (1:10-50), Immunohistochemistry (1:50-100), Western Blot (1:100-500); Reactive Species: Human
Host Organism: rabbit
Clonality: polyclonal
Target(s): RPLP0

Proper citation: Thermo Fisher Scientific Cat# PA5-26096, RRID:AB_2543596 Copy   


http://antibodyregistry.org/AB_2502400

Comments: WB
Host Organism: rabbit
Clonality: unknown

Proper citation: Creative Diagnostics Cat# DPABH-24916, RRID:AB_2502400 Copy   


http://antibodyregistry.org/AB_2797433

Comments: Applications: WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): CD123

Proper citation: Bioworld Technology Cat# AP0797, RRID:AB_2797433 Copy   


  • RRID:AB_2885933

http://antibodyregistry.org/AB_2885933

Comments: Applications: WB, IP
Host Organism: rabbit
Clonality: polyclonal
Target(s): PMS1

Proper citation: GeneTex Cat# GTX129232, RRID:AB_2885933 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2673360

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MICAL1

Proper citation: Atlas Antibodies Cat# HPA030176, RRID:AB_2673360 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686413

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ITGB1BP1

Proper citation: Atlas Antibodies Cat# HPA071538, RRID:AB_2686413 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078967

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GIT1

Proper citation: Atlas Antibodies Cat# HPA004186, RRID:AB_1078967 Copy   


http://antibodyregistry.org/AB_2796194

Comments: Original manufacturer of this product; ISO 9001:2015
Host Organism: rabbit
Clonality: unknown
Target(s): IgG(H+L)

Proper citation: SouthernBiotech Cat# 6140-01, RRID:AB_2796194 Copy   


http://antibodyregistry.org/AB_2796084

Comments: Original manufacturer of this product; ISO 9001:2015
Host Organism: rabbit
Clonality: unknown
Target(s): IgG(H+L)

Proper citation: SouthernBiotech Cat# 6000-04, RRID:AB_2796084 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682994

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RGLGTAMLRDFCETFPEDEALGVSCPMSPAMYQAHPGNSEDVSRHARTSQNDRPRQPAPGDGSKERMCGEELEDTKDDPEC; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM169B

Proper citation: Atlas Antibodies Cat# HPA055979, RRID:AB_2682994 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681369

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): METRN

Proper citation: Atlas Antibodies Cat# HPA051164, RRID:AB_2681369 Copy   


  • RRID:AB_10893577

Discontinued

http://antibodyregistry.org/AB_10893577

Comments: Discontinued; Applications: IHC (1:500-1:5,000), IP (2-10 µg/mg lysate)
Host Organism: rabbit
Clonality: polyclonal
Target(s): HSF1

Proper citation: Thermo Fisher Scientific Cat# A303-174A, RRID:AB_10893577 Copy   


Discontinued

http://antibodyregistry.org/AB_2662681

Comments: Discontinued: 2018; Vendor recommended applications: IF (1-4 ug/ml), ICC (1-4 ug/ml)
Host Organism: rabbit
Clonality: polyclonal
Target(s): Tenascin X

Proper citation: Thermo Fisher Scientific Cat# PA5-67105, RRID:AB_2662681 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686280

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPRY1

Proper citation: Atlas Antibodies Cat# HPA070554, RRID:AB_2686280 Copy   


  • RRID:AB_2682924

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682924

Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PLOD1

Proper citation: Atlas Antibodies Cat# HPA055799, RRID:AB_2682924 Copy   


http://antibodyregistry.org/AB_2864052

Comments: Applications: WB
Host Organism: rabbit
Clonality: unknown

Proper citation: ABclonal Cat# AP1197, RRID:AB_2864052 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794269

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZSWIM8

Proper citation: Atlas Antibodies Cat# HPA041244, RRID:AB_10794269 Copy   


  • RRID:AB_2885936

http://antibodyregistry.org/AB_2885936

Comments: Applications: WB, ICC/IF, IP
Host Organism: rabbit
Clonality: polyclonal
Target(s): TCF3

Proper citation: GeneTex Cat# GTX129237, RRID:AB_2885936 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685298

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMSB15B

Proper citation: Atlas Antibodies Cat# HPA064607, RRID:AB_2685298 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X