Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601135
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MARC1
Proper citation: Atlas Antibodies Cat# HPA028702, RRID:AB_10601135 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601375
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ETV7
Proper citation: Atlas Antibodies Cat# HPA029033, RRID:AB_10601375 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602236
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HOXC8
Proper citation: Atlas Antibodies Cat# HPA028911, RRID:AB_10602236 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672782
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HTR1B
Proper citation: Atlas Antibodies Cat# HPA028808, RRID:AB_2672782 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669867
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AP000322.53
Proper citation: Atlas Antibodies Cat# HPA029085, RRID:AB_10669867 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602492
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ELK4
Proper citation: Atlas Antibodies Cat# HPA028863, RRID:AB_10602492 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670830
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): AUNIP
Proper citation: Atlas Antibodies Cat# HPA028730, RRID:AB_10670830 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10610978
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CCDC190
Proper citation: Atlas Antibodies Cat# HPA028579, RRID:AB_10610978 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602339
Comments: Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CALCR
Proper citation: Atlas Antibodies Cat# HPA028962, RRID:AB_10602339 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602138
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GOT1L1
Proper citation: Atlas Antibodies Cat# HPA028778, RRID:AB_10602138 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603983
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PFDN2
Proper citation: Atlas Antibodies Cat# HPA028700, RRID:AB_10603983 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602679
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): VAX1
Proper citation: Atlas Antibodies Cat# HPA028946, RRID:AB_10602679 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602714
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NRBP2
Proper citation: Atlas Antibodies Cat# HPA029052, RRID:AB_10602714 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600988
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PPP2R5D
Proper citation: Atlas Antibodies Cat# HPA029046, RRID:AB_10600988 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601719
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TARS2
Proper citation: Atlas Antibodies Cat# HPA028626, RRID:AB_10601719 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672771
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): P2RX6
Proper citation: Atlas Antibodies Cat# HPA028776, RRID:AB_2672771 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603662
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DNAJC11
Proper citation: Atlas Antibodies Cat# HPA028705, RRID:AB_10603662 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672714
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NVL
Proper citation: Atlas Antibodies Cat# HPA028654, RRID:AB_2672714 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603845
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF514
Proper citation: Atlas Antibodies Cat# HPA028974, RRID:AB_10603845 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599302
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): OTUD3
Proper citation: Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
