Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Target Organism:human (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

2,504,750 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-PLEKHA5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035923, RRID:AB_10673491 PLEKHA5 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673491 Atlas Antibodies HPA035923 2026-08-29 07:37:50 0
Anti-MAP7D3 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA035598, RRID:AB_10671108 MAP7D3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671108 Atlas Antibodies HPA035598 2026-08-28 10:52:43 3
Anti-MRPS18A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035450, RRID:AB_10670701 MRPS18A human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670701 Atlas Antibodies HPA035450 2026-08-31 12:09:30 0
Anti-SLC9A2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035121, RRID:AB_10602894 SLC9A2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602894 Atlas Antibodies HPA035121 2026-08-31 08:04:14 0
Anti-IKZF1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035221, RRID:AB_2674524 IKZF1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2674524 Atlas Antibodies HPA035221 2026-08-31 06:08:18 0
Anti-HIKESHI
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035064, RRID:AB_2674441 HIKESHI human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2674441 Atlas Antibodies HPA035064 2026-08-31 07:33:06 0
Anti-GCA
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035034, RRID:AB_10669900 GCA human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10669900 Atlas Antibodies HPA035034 2026-08-28 08:03:55 0
Anti-KANSL3 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA035018, RRID:AB_10601763 KANSL3 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601763 Atlas Antibodies HPA035018 2026-08-28 08:01:44 3
Anti-CCDC14 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035278, RRID:AB_2674548 CCDC14 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2674548 Atlas Antibodies HPA035278 2026-08-31 06:33:21 0
Anti-ECT2L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035488, RRID:AB_10672865 ECT2L human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10672865 Atlas Antibodies HPA035488 2026-08-31 01:57:42 0
Anti-NDUFAF3
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035376, RRID:AB_2674597 NDUFAF3 human Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2674597 Atlas Antibodies HPA035376 2026-08-28 06:11:38 0
Anti-IL1RAP polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035293, RRID:AB_10671511 IL1RAP human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671511 Atlas Antibodies HPA035293 2026-08-31 05:15:21 0
Anti-SEC13
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035292, RRID:AB_10959451 SEC13 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10959451 Atlas Antibodies HPA035292 2026-08-28 08:34:10 0
Anti-PHLDB2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035147, RRID:AB_2674492 PHLDB2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2674492 Atlas Antibodies HPA035147 2026-08-29 01:14:54 0
Anti-KLHL18 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035028, RRID:AB_10669899 KLHL18 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10669899 Atlas Antibodies HPA035028 2026-08-31 07:55:11 0
Anti-SLC9A2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035122, RRID:AB_2674477 SLC9A2 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2674477 Atlas Antibodies HPA035122 2026-08-29 03:04:07 0
Anti-ZMYND10 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA035255, RRID:AB_10601928 ZMYND10 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNT; Manufacturer approved use: ICC-IF, IHC polyclonal rabbit AB_10601928 Atlas Antibodies HPA035255 2026-08-29 02:45:24 1
Anti-NDUFAF3
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035377, RRID:AB_10673219 NDUFAF3 Human, Rat Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10673219 Atlas Antibodies HPA035377 2026-08-29 06:50:02 0
Anti-SLC30A5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035373, RRID:AB_10794630 SLC30A5 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794630 Atlas Antibodies HPA035373 2026-08-31 02:39:47 0
Anti-SLC25A12
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035334, RRID:AB_2674577 SLC25A12 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2674577 Atlas Antibodies HPA035334 2026-08-28 07:26:41 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.