Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 363 showing 7241 ~ 7260 out of 1,488,197 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

    • RRID:AB_10869969

http://antibodyregistry.org/AB_10869969

Comments: vendor suggested use: Western Blot; WB (1 µg/ml)
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARID3B

Proper citation: LSBio (LifeSpan) Cat# LS-C134981-50, RRID:AB_10869969 Copy   

http://antibodyregistry.org/AB_1808261

Comments: vendor suggested use: Immunohistochemistry; Immunohistochemistry (Parrafin) (1:50 - 1:100)
Host Organism: rabbit
Clonality: monoclonal
Target(s): Rat Cyclooxygenase-2 (PTGS2)

Proper citation: LSBio (LifeSpan) Cat# LS-C88842-0.1, RRID:AB_1808261 Copy   

    • RRID:AB_10814865

http://antibodyregistry.org/AB_10814865

Comments: manufacturer recommendations: Western Blot; WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): Occludin antibody

Proper citation: Fitzgerald Industries International Cat# 70R-6335, RRID:AB_10814865 Copy   

    • RRID:AB_10675762

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_10675762

Comments: validation status unknown, seller recommendations provided in 2012: IP, WB; Immunoprecipitation; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): Exonuclease 1 antibody

Proper citation: Abcam Cat# ab95068, RRID:AB_10675762 Copy   

Discontinued

http://antibodyregistry.org/AB_1240676

Comments: Discontinued; manufacturer recommendations: Western Blot; Dot blot. The usefulness of this product in other applications has not been determined.
Host Organism: rabbit
Clonality: polyclonal
Target(s): Human CSTB

Proper citation: GeneTex Cat# GTX100227, RRID:AB_1240676 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10669537

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFQSQTAIKHANSVDTSFSKDVLNSIAAFSSIAISTVNHADSRASLASLDSNPSTNEK; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): DOCK10

Proper citation: Atlas Antibodies Cat# HPA035749, RRID:AB_10669537 Copy   

    • RRID:AB_11205284

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_11205284

Comments: Discontinued; Applications: IP (2-10 µg/mg lysate)
Host Organism: rabbit
Clonality: polyclonal
Target(s): ETV3

Proper citation: Thermo Fisher Scientific Cat# A303-736A, RRID:AB_11205284 Copy   

    • RRID:AB_10898642

http://antibodyregistry.org/AB_10898642

Comments: validation status unknown, seller recommendations provided in 2012: WB; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM109B antibody

Proper citation: Abcam Cat# ab115999, RRID:AB_10898642 Copy   

http://antibodyregistry.org/AB_2764547

Comments: Applications:WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDC25A

Proper citation: ABclonal Cat# A2687, RRID:AB_2764547 Copy   

    • RRID:AB_2766815

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2766815

Comments: Applications:IHC, IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): BGLAP

Proper citation: ABclonal Cat# A6205, RRID:AB_2766815 Copy   

    • RRID:AB_10845110

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_10845110

Comments: validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Immunofluorescence; Western Blot; WB, IP, IF, ELISA
Host Organism: rabbit
Clonality: monoclonal
Target(s): DOCK 8 (H-159)

Proper citation: Santa Cruz Biotechnology Cat# sc-292124, RRID:AB_10845110 Copy   

    • RRID:AB_10808411

http://antibodyregistry.org/AB_10808411

Comments: manufacturer recommendations: Immunohistochemistry; Western Blot; WB, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): SFRS10 antibody

Proper citation: Fitzgerald Industries International Cat# 70R-1420, RRID:AB_10808411 Copy   

    • RRID:AB_2800110

http://antibodyregistry.org/AB_2800110

Comments: Applications: W, IP
Host Organism: rabbit
Clonality: unknown
Target(s): LAIR-1

Proper citation: Cell Signaling Technology Cat# 87923, RRID:AB_2800110 Copy   

http://antibodyregistry.org/AB_10757225

Comments: manufacturer recommendations: IgG Immunohistochemistry; ELISA; Western Blot; ELISA, WB, IHC-P
Host Organism: rabbit
Clonality: polyclonal
Target(s): Nebulin antibody (FITC)

Proper citation: Biorbyt Cat# orb14166, RRID:AB_10757225 Copy   

    • RRID:AB_2037305

Discontinued

http://antibodyregistry.org/AB_2037305

Comments: Discontinued; manufacturer recommendations: Western Blot; Antibody reactive against recombinant protein, detects immunogen. Further validation in progress. Western Blot.
Host Organism: rabbit
Clonality: polyclonal
Target(s): FASTKD2 antibody

Proper citation: GeneTex Cat# GTX104313, RRID:AB_2037305 Copy   

    • RRID:AB_2862655

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2862655

Comments: Applications: WB
Host Organism: rabbit
Clonality: monoclonal

Proper citation: ABclonal Cat# A19538, RRID:AB_2862655 Copy   

    • RRID:AB_2042903

http://antibodyregistry.org/AB_2042903

Comments: validation status unknown, seller recommendations provided in 2012: Western Blot; WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): NSP3 antibody

Proper citation: Abcam Cat# ab89803, RRID:AB_2042903 Copy   

http://antibodyregistry.org/AB_10874935

Comments: manufacturer recommendations: FN*, WB*
Host Organism: rabbit
Clonality: unknown
Target(s): RABBIT ANTI HUMAN FGF BASIC

Proper citation: Aviva Systems Biology Cat# OASA07745, RRID:AB_10874935 Copy   

Discontinued

http://antibodyregistry.org/AB_2037308

Comments: Discontinued; manufacturer recommendations: Western Blot; Antibody reactive against recombinant protein, detects immunogen. Further validation in progress. Western Blot.
Host Organism: rabbit
Clonality: polyclonal
Target(s): Hexokinase II antibody

Proper citation: GeneTex Cat# GTX107912, RRID:AB_2037308 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080760

Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human TJP1

Proper citation: Sigma-Aldrich Cat# HPA001637, RRID:AB_1080760 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch