Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10805359
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): SKA3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA039272, RRID:AB_10805359 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079697
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human PRSS21
Proper citation: Sigma-Aldrich Cat# HPA008477, RRID:AB_1079697 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794866
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): N4BP1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040849, RRID:AB_10794866 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682148
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): TAF9
Proper citation: Atlas Antibodies Cat# HPA053429, RRID:AB_2682148 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959306
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TMEM97
Proper citation: Atlas Antibodies Cat# HPA044795, RRID:AB_10959306 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078312
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human C10orf58
Proper citation: Sigma-Aldrich Cat# HPA009025, RRID:AB_1078312 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847587
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human DECR1
Proper citation: Sigma-Aldrich Cat# HPA023238, RRID:AB_1847587 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844500
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human LARP6
Proper citation: Sigma-Aldrich Cat# HPA020338, RRID:AB_1844500 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_331466
Comments: Applications: W, IP. Consolidation on 10/2018: AB_10077539, AB_10828105, AB_331466. Info: Used By NYUIHC-791.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): Phospho-p53 (Ser6)
Proper citation: Cell Signaling Technology Cat# 9285, RRID:AB_331466 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965992
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): ALDH1A3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA046271, RRID:AB_10965992 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844434
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ABCC4
Proper citation: Atlas Antibodies Cat# HPA002476, RRID:AB_1844434 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2072067
Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC25 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA023256, RRID:AB_2072067 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965328
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): C9orf173 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044352, RRID:AB_10965328 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10970597
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): PCDHA5 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044557, RRID:AB_10970597 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847848
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): DPM3
Proper citation: Atlas Antibodies Cat# HPA014667, RRID:AB_1847848 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844656
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AHNAK
Proper citation: Atlas Antibodies Cat# HPA019070, RRID:AB_1844656 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847622
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DFFA
Proper citation: Atlas Antibodies Cat# HPA018859, RRID:AB_1847622 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845664
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BPIFB1
Proper citation: Atlas Antibodies Cat# HPA024256, RRID:AB_1845664 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2563507
Comments: Applications: FC
Host Organism: mouse
Clonality monoclonal
Target(s): CD3
Proper citation: BioLegend Cat# 317330, RRID:AB_2563507 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965844
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): FSTL4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045920, RRID:AB_10965844 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
