Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855943
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PTPRT
Proper citation: Atlas Antibodies Cat# HPA017336, RRID:AB_1855943 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2259720
Comments: Applications: Western Blot, Intracellular Staining by Flow Cytometry, CyTOF-ready, ELISA Capture (Matched Antibody Pair)
Host Organism: Mouse
Clonality monoclonal
Target(s): CCL18/PARC
Proper citation: R and D Systems Cat# MAB394, RRID:AB_2259720 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10967713
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): HSPB2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA038890, RRID:AB_10967713 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1159209
Comments: Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism:
Clonality monoclonal
Target(s): CD31
Proper citation: Cell Marque Cat# 131M-18, RRID:AB_1159209 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_309446
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): TAFII68
Proper citation: Bethyl Cat# A300-307A, RRID:AB_309446 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960052
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RNF111
Proper citation: Atlas Antibodies Cat# HPA038577, RRID:AB_10960052 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599994
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ALDH5A1
Proper citation: Atlas Antibodies Cat# HPA029715, RRID:AB_10599994 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079622
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PITPNB
Proper citation: Atlas Antibodies Cat# HPA000528, RRID:AB_1079622 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856978
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC15A4
Proper citation: Atlas Antibodies Cat# HPA016713, RRID:AB_1856978 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599298
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): COLGALT2
Proper citation: Atlas Antibodies Cat# HPA031749, RRID:AB_10599298 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601549
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DZIP3
Proper citation: Atlas Antibodies Cat# HPA035066, RRID:AB_10601549 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683356
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM175
Proper citation: Atlas Antibodies Cat# HPA057160, RRID:AB_2683356 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682582
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): EMC9
Proper citation: Atlas Antibodies Cat# HPA054715, RRID:AB_2682582 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672617
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GQIPNTNIYRSINDYREIITIPGVKIFQCCSSITFVNVYYLKHKLLKEVDMVKVPLKEEEIFSLFNSSDTNLQGGKICRCFCNCDD; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC26A8
Proper citation: Atlas Antibodies Cat# HPA038080, RRID:AB_10672617 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603344
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TAS2R60
Proper citation: Atlas Antibodies Cat# HPA030416, RRID:AB_10603344 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858820
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): DCAF7
Proper citation: Atlas Antibodies Cat# HPA022948, RRID:AB_1858820 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795105
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): USPL1
Proper citation: Atlas Antibodies Cat# HPA039342, RRID:AB_10795105 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_925354
Comments: Applications: Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin, Western Blot (Negative)
Host Organism: Rabbit
Clonality polyclonal
Target(s): DEK
Proper citation: Novus Cat# NB100-61057, RRID:AB_925354 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678795
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): STIP1
Proper citation: Atlas Antibodies Cat# HPA044062, RRID:AB_2678795 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601145
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DAIYRQLCDNNCMKDVMLQVITLLTCTSPKKVIFQLMDYPVPADDTLIQMWKAACSQASVAPHVLKTILLILKGKPGEMEDTVTEGKRFSLDITN; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): MROH9
Proper citation: Atlas Antibodies Cat# HPA028413, RRID:AB_10601145 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.