Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2670348
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NET1
Proper citation: (Atlas Antibodies Cat# HPA020068, RRID:AB_2670348) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2176551
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PTCD1
Proper citation: (Atlas Antibodies Cat# HPA020106, RRID:AB_2176551) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851849
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PNPLA8
Proper citation: (Atlas Antibodies Cat# HPA020083, RRID:AB_1851849) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846185
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCM2
Proper citation: (Atlas Antibodies Cat# HPA020273, RRID:AB_1846185) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2170360
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PPM1L
Proper citation: (Atlas Antibodies Cat# HPA019953, RRID:AB_2170360) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844693
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): AKAP4
Proper citation: (Atlas Antibodies Cat# HPA020046, RRID:AB_1844693) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855318
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PLCD1
Proper citation: (Atlas Antibodies Cat# HPA020107, RRID:AB_1855318) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2670400
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BCL9
Proper citation: (Atlas Antibodies Cat# HPA020274, RRID:AB_2670400) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847890
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DUSP16
Proper citation: (Atlas Antibodies Cat# HPA020326, RRID:AB_1847890) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858989
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NKEECGKGPKRIFAPPAQKSYSLLPCSPNSPKEETPGISSPETEARISLPKASLKKKEEKATMKNVPSREQEKKRKAQINKQA; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZCWPW1
Proper citation: (Atlas Antibodies Cat# HPA020061, RRID:AB_1858989) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855292
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): JADE1
Proper citation: (Atlas Antibodies Cat# HPA020016, RRID:AB_1855292) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852452
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CCAR2
Proper citation: (Atlas Antibodies Cat# HPA019907, RRID:AB_1852452) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857498
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SSH3
Proper citation: (Atlas Antibodies Cat# HPA019949, RRID:AB_1857498) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2072056
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CCDC146
Proper citation: (Atlas Antibodies Cat# HPA020105, RRID:AB_2072056) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856728
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SERPINB5
Proper citation: (Atlas Antibodies Cat# HPA020136, RRID:AB_1856728) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856514
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): RUVBL1
Proper citation: (Atlas Antibodies Cat# HPA019948, RRID:AB_1856514) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855628
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PPM1K
Proper citation: (Atlas Antibodies Cat# HPA020066, RRID:AB_1855628) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844386
Comments: Originating manufacturer of this product. Applications: WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): MACC1
Proper citation: (Atlas Antibodies Cat# HPA020081, RRID:AB_1844386) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858280
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRIM29
Proper citation: (Atlas Antibodies Cat# HPA020053, RRID:AB_1858280) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855595
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PAEP
Proper citation: (Atlas Antibodies Cat# HPA020108, RRID:AB_1855595) Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.