Searching across hundreds of databases

Our searching services are busy right now. Your search will reload in five seconds.

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 4 showing 61 ~ 80 out of 51,216 results
Snippet view Table view Download
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2670348

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NET1

Proper citation: (Atlas Antibodies Cat# HPA020068, RRID:AB_2670348) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2176551

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PTCD1

Proper citation: (Atlas Antibodies Cat# HPA020106, RRID:AB_2176551) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1851849

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PNPLA8

Proper citation: (Atlas Antibodies Cat# HPA020083, RRID:AB_1851849) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1846185

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCM2

Proper citation: (Atlas Antibodies Cat# HPA020273, RRID:AB_1846185) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2170360

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PPM1L

Proper citation: (Atlas Antibodies Cat# HPA019953, RRID:AB_2170360) Copy   


  • RRID:AB_1844693

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844693

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): AKAP4

Proper citation: (Atlas Antibodies Cat# HPA020046, RRID:AB_1844693) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855318

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PLCD1

Proper citation: (Atlas Antibodies Cat# HPA020107, RRID:AB_1855318) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2670400

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BCL9

Proper citation: (Atlas Antibodies Cat# HPA020274, RRID:AB_2670400) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847890

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DUSP16

Proper citation: (Atlas Antibodies Cat# HPA020326, RRID:AB_1847890) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1858989

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NKEECGKGPKRIFAPPAQKSYSLLPCSPNSPKEETPGISSPETEARISLPKASLKKKEEKATMKNVPSREQEKKRKAQINKQA; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZCWPW1

Proper citation: (Atlas Antibodies Cat# HPA020061, RRID:AB_1858989) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855292

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): JADE1

Proper citation: (Atlas Antibodies Cat# HPA020016, RRID:AB_1855292) Copy   


  • RRID:AB_1852452

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1852452

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CCAR2

Proper citation: (Atlas Antibodies Cat# HPA019907, RRID:AB_1852452) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1857498

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SSH3

Proper citation: (Atlas Antibodies Cat# HPA019949, RRID:AB_1857498) Copy   


  • RRID:AB_2072056

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2072056

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CCDC146

Proper citation: (Atlas Antibodies Cat# HPA020105, RRID:AB_2072056) Copy   


  • RRID:AB_1856728

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1856728

Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SERPINB5

Proper citation: (Atlas Antibodies Cat# HPA020136, RRID:AB_1856728) Copy   


  • RRID:AB_1856514

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1856514

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): RUVBL1

Proper citation: (Atlas Antibodies Cat# HPA019948, RRID:AB_1856514) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855628

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PPM1K

Proper citation: (Atlas Antibodies Cat# HPA020066, RRID:AB_1855628) Copy   


  • RRID:AB_1844386

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844386

Comments: Originating manufacturer of this product. Applications: WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): MACC1

Proper citation: (Atlas Antibodies Cat# HPA020081, RRID:AB_1844386) Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1858280

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRIM29

Proper citation: (Atlas Antibodies Cat# HPA020053, RRID:AB_1858280) Copy   


  • RRID:AB_1855595

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855595

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PAEP

Proper citation: (Atlas Antibodies Cat# HPA020108, RRID:AB_1855595) Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X