Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794085
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MCRS1
Proper citation: Atlas Antibodies Cat# HPA039057, RRID:AB_10794085 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676229
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZC3H12C
Proper citation: Atlas Antibodies Cat# HPA038836, RRID:AB_2676229 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795173
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRIM7
Proper citation: Atlas Antibodies Cat# HPA039213, RRID:AB_10795173 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673414
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HERC3
Proper citation: Atlas Antibodies Cat# HPA039170, RRID:AB_10673414 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960427
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TCAF2
Proper citation: Atlas Antibodies Cat# HPA038756, RRID:AB_10960427 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676184
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANKRD1
Proper citation: Atlas Antibodies Cat# HPA038736, RRID:AB_2676184 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795034
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SKIDA1
Proper citation: Atlas Antibodies Cat# HPA039208, RRID:AB_10795034 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10674980
Comments: Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): OTUB1
Proper citation: Atlas Antibodies Cat# HPA039176, RRID:AB_10674980 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673601
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ZCCHC10
Proper citation: Atlas Antibodies Cat# HPA038944, RRID:AB_10673601 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10674847
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): VPS11
Proper citation: Atlas Antibodies Cat# HPA039020, RRID:AB_10674847 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676345
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RITA1
Proper citation: Atlas Antibodies Cat# HPA039095, RRID:AB_2676345 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673408
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): N4BP2L1
Proper citation: Atlas Antibodies Cat# HPA038971, RRID:AB_10673408 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673606
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C1orf167
Proper citation: Atlas Antibodies Cat# HPA039114, RRID:AB_10673606 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673295
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARHGAP44
Proper citation: Atlas Antibodies Cat# HPA038814, RRID:AB_10673295 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676316
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FSPSHKTTRFGTLFERLNSLGNRNLLTKSPAVIMDEDCRSTDEIRQSDYITEKHSIQHIWGKNGKEVSNFLEDVNQSTPNLLSENCDSFVS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): C12orf40
Proper citation: Atlas Antibodies Cat# HPA039032, RRID:AB_2676316 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796222
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GADL1
Proper citation: Atlas Antibodies Cat# HPA039160, RRID:AB_10796222 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795031
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): USP6NL
Proper citation: Atlas Antibodies Cat# HPA039196, RRID:AB_10795031 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670916
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FDXACB1
Proper citation: Atlas Antibodies Cat# HPA039012, RRID:AB_10670916 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672652
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PNISR
Proper citation: Atlas Antibodies Cat# HPA038796, RRID:AB_10672652 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672718
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ALG9
Proper citation: Atlas Antibodies Cat# HPA038575, RRID:AB_10672718 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.