Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_3484598
Comments: Applications: Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): PECR
Proper citation: Novus Cat# NBP2-97904AF700, RRID:AB_3484598 Copy
http://antibodyregistry.org/AB_3479720
Comments: Applications: Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): PCYOX1L
Proper citation: Novus Cat# NBP2-97684PE, RRID:AB_3479720 Copy
http://antibodyregistry.org/AB_3341469
Comments: Applications: Immunocytochemistry/ Immunofluorescence
Host Organism: Rabbit
Clonality: polyclonal
Target(s): ID4
Proper citation: Novus Cat# NBP2-56322, RRID:AB_3341469 Copy
http://antibodyregistry.org/AB_3342797
Comments: Applications: Western Blot, Immunocytochemistry/ Immunofluorescence
Host Organism: Rabbit
Clonality: polyclonal
Target(s): Lhx8
Proper citation: Novus Cat# NBP2-57782, RRID:AB_3342797 Copy
http://antibodyregistry.org/AB_3487502
Comments: Applications: Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): C5orf49
Proper citation: Novus Cat# NBP2-98031R, RRID:AB_3487502 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680327
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKE; Manufacturer approved use: ICC-IF, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): CFDP1
Proper citation: Atlas Antibodies Cat# HPA048242, RRID:AB_2680327 Copy
http://antibodyregistry.org/AB_3482925
Comments: Applications: Western Blot
Host Organism: Rabbit
Clonality: polyclonal
Target(s): PPP1R7
Proper citation: Novus Cat# NBP2-97835G, RRID:AB_3482925 Copy
http://antibodyregistry.org/AB_3482864
Comments: Applications: Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): PAPOLA
Proper citation: Novus Cat# NBP2-97833B, RRID:AB_3482864 Copy
http://antibodyregistry.org/AB_3467861
Comments: Applications: Immunocytochemistry/ Immunofluorescence
Host Organism: Rabbit
Clonality: polyclonal
Target(s): THAP11
Proper citation: Novus Cat# NBP2-97155AF350, RRID:AB_3467861 Copy
http://antibodyregistry.org/AB_3497551
Comments: Applications: Western Blot, Immunocytochemistry/ Immunofluorescence
Host Organism: Rabbit
Clonality: polyclonal
Target(s): AARS2
Proper citation: Novus Cat# NBP2-98582F, RRID:AB_3497551 Copy
http://antibodyregistry.org/AB_3496067
Comments: Applications: Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): MIOX
Proper citation: Novus Cat# NBP2-98517DL594, RRID:AB_3496067 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683978
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TTLL7
Proper citation: Atlas Antibodies Cat# HPA059321, RRID:AB_2683978 Copy
http://antibodyregistry.org/AB_3498324
Comments: Applications: Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): SAH3
Proper citation: Novus Cat# NBP2-98616AF594, RRID:AB_3498324 Copy
http://antibodyregistry.org/AB_2649501
Comments: Applications: IHC-P
Host Organism: rabbit
Clonality: polyclonal
Target(s): VTI1B
Proper citation: Thermo Fisher Scientific Cat# PA5-63817, RRID:AB_2649501 Copy
http://antibodyregistry.org/AB_3497808
Comments: Applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): ACADSB
Proper citation: Novus Cat# NBP2-98594JF549, RRID:AB_3497808 Copy
http://antibodyregistry.org/AB_3496859
Comments: Applications: Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): OIP106
Proper citation: Novus Cat# NBP2-98550MFV450, RRID:AB_3496859 Copy
http://antibodyregistry.org/AB_3483822
Comments: Applications: Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): SLBP
Proper citation: Novus Cat# NBP2-97869H, RRID:AB_3483822 Copy
http://antibodyregistry.org/AB_3343129
Comments: Applications: Immunohistochemistry, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): SMURF1
Proper citation: Novus Cat# NBP2-58156, RRID:AB_3343129 Copy
http://antibodyregistry.org/AB_3497963
Comments: Applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): CUTC
Proper citation: Novus Cat# NBP2-98601AF750, RRID:AB_3497963 Copy
http://antibodyregistry.org/AB_3487722
Comments: Applications: Immunocytochemistry/ Immunofluorescence
Host Organism: Rabbit
Clonality: polyclonal
Target(s): NGX6
Proper citation: Novus Cat# NBP2-98040PE, RRID:AB_3487722 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.