Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
PECR Antibody [Alexa Fluor® 700] Resource Report Resource Website |
Novus Cat# NBP2-97904AF700, RRID:AB_3484598 | PECR | Human | Applications: Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3484598 | Novus | NBP2-97904AF700 | 2025-08-19 10:19:00 | 0 | ||
|
PCYOX1L Antibody [PE] Resource Report Resource Website |
Novus Cat# NBP2-97684PE, RRID:AB_3479720 | PCYOX1L | Human | Applications: Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3479720 | Novus | NBP2-97684PE | 2025-08-19 10:19:16 | 0 | ||
|
ID4 Antibody Resource Report Resource Website |
Novus Cat# NBP2-56322, RRID:AB_3341469 | ID4 | Human, Rat | Applications: Immunocytochemistry/ Immunofluorescence | polyclonal | Rabbit | AB_3341469 | Novus | NBP2-56322 (also NBP2-56322-25ul) | 2025-08-19 10:19:17 | 0 | ||
|
Lhx8 Antibody Resource Report Resource Website |
Novus Cat# NBP2-57782, RRID:AB_3342797 | Lhx8 | Human | Applications: Western Blot, Immunocytochemistry/ Immunofluorescence | polyclonal | Rabbit | AB_3342797 | Novus | NBP2-57782 (also NBP2-57782-25ul) | 2025-08-19 10:19:17 | 0 | ||
|
C5orf49 Antibody [DyLight 550] Resource Report Resource Website |
Novus Cat# NBP2-98031R, RRID:AB_3487502 | C5orf49 | Human | Applications: Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3487502 | Novus | NBP2-98031R | 2025-08-19 10:18:59 | 0 | ||
|
Anti-CFDP1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048242, RRID:AB_2680327 | CFDP1 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKE; Manufacturer approved use: ICC-IF, WB | polyclonal | rabbit | AB_2680327 | Atlas Antibodies | HPA048242 | 2025-08-19 10:19:01 | 0 | ||
|
PPP1R7 Antibody [DyLight 488] Resource Report Resource Website |
Novus Cat# NBP2-97835G, RRID:AB_3482925 | PPP1R7 | Human | Applications: Western Blot | polyclonal | Rabbit | AB_3482925 | Novus | NBP2-97835G | 2025-08-19 10:19:17 | 0 | ||
|
PAPOLA Antibody [Biotin] Resource Report Resource Website |
Novus Cat# NBP2-97833B, RRID:AB_3482864 | PAPOLA | Human | Applications: Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3482864 | Novus | NBP2-97833B | 2025-08-19 10:18:59 | 0 | ||
|
THAP11 Antibody [Alexa Fluor® 350] Resource Report Resource Website |
Novus Cat# NBP2-97155AF350, RRID:AB_3467861 | THAP11 | Human | Applications: Immunocytochemistry/ Immunofluorescence | polyclonal | Rabbit | AB_3467861 | Novus | NBP2-97155AF350 | 2025-08-19 10:18:58 | 0 | ||
|
AARS2 Antibody [FITC] Resource Report Resource Website |
Novus Cat# NBP2-98582F, RRID:AB_3497551 | AARS2 | Human | Applications: Western Blot, Immunocytochemistry/ Immunofluorescence | polyclonal | Rabbit | AB_3497551 | Novus | NBP2-98582F | 2025-08-19 10:19:19 | 0 | ||
|
MIOX Antibody [DyLight 594] Resource Report Resource Website |
Novus Cat# NBP2-98517DL594, RRID:AB_3496067 | MIOX | Human | Applications: Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3496067 | Novus | NBP2-98517DL594 | 2025-08-19 10:19:01 | 0 | ||
|
Anti-TTLL7 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA059321, RRID:AB_2683978 | TTLL7 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2683978 | Atlas Antibodies | HPA059321 | 2025-08-19 10:19:01 | 0 | ||
|
SAH3 Antibody [Alexa Fluor® 594] Resource Report Resource Website |
Novus Cat# NBP2-98616AF594, RRID:AB_3498324 | SAH3 | Human | Applications: Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3498324 | Novus | NBP2-98616AF594 | 2025-08-19 10:19:19 | 0 | ||
|
VTI1B Polyclonal Antibody Resource Report Resource Website |
Thermo Fisher Scientific Cat# PA5-63817, RRID:AB_2649501 | VTI1B | human | Applications: IHC-P | polyclonal | rabbit | AB_2649501 | Thermo Fisher Scientific | PA5-63817 | 2025-08-19 10:19:00 | 0 | ||
|
ACADSB Antibody [Janelia Fluor® 549] Resource Report Resource Website |
Novus Cat# NBP2-98594JF549, RRID:AB_3497808 | ACADSB | Human | Applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3497808 | Novus | NBP2-98594JF549 | 2025-08-19 10:19:01 | 0 | ||
|
OIP106 Antibody [mFluor Violet 450 SE] Resource Report Resource Website |
Novus Cat# NBP2-98550MFV450, RRID:AB_3496859 | OIP106 | Human | Applications: Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3496859 | Novus | NBP2-98550MFV450 | 2025-08-19 10:19:01 | 0 | ||
|
SLBP Antibody [HRP] Resource Report Resource Website |
Novus Cat# NBP2-97869H, RRID:AB_3483822 | SLBP | Human | Applications: Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3483822 | Novus | NBP2-97869H | 2025-08-19 10:19:17 | 0 | ||
|
SMURF1 Antibody Resource Report Resource Website |
Novus Cat# NBP2-58156, RRID:AB_3343129 | SMURF1 | Human | Applications: Immunohistochemistry, Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3343129 | Novus | NBP2-58156 (also NBP2-58156-25ul) | 2025-08-19 10:19:18 | 0 | ||
|
CUTC Antibody [Alexa Fluor® 750] Resource Report Resource Website |
Novus Cat# NBP2-98601AF750, RRID:AB_3497963 | CUTC | Human | Applications: Western Blot, Immunoprecipitation, Immunohistochemistry-Paraffin | polyclonal | Rabbit | AB_3497963 | Novus | NBP2-98601AF750 | 2025-08-19 10:19:01 | 0 | ||
|
NGX6 Antibody [PE] Resource Report Resource Website |
Novus Cat# NBP2-98040PE, RRID:AB_3487722 | NGX6 | Human | Applications: Immunocytochemistry/ Immunofluorescence | polyclonal | Rabbit | AB_3487722 | Novus | NBP2-98040PE | 2025-08-19 10:19:17 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
