Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_3666988
Comments: Applications: ELISA, Neu
Host Organism: Alpaca
Clonality recombinant monoclonal
Target(s): TLR2 VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54740, RRID:AB_3666988 Copy
http://antibodyregistry.org/AB_3075915
Comments: Applications: IF
Host Organism: Alpaca
Clonality monoclonal
Target(s): mRFP and derivatives like mCherry, mScarlet-i, tdTomato, dsRed, mOrange
Proper citation: NanoTag Biotechnologies Cat# N0401-AF568-L, RRID:AB_3075915 Copy
http://antibodyregistry.org/AB_3076052
Comments: Applications: IF, WB
Host Organism: Alpaca
Clonality monoclonal
Target(s): Mouse IgG2, does not cross-react with rabbit, guinea pig or chicken immunoglobulins
Proper citation: NanoTag Biotechnologies Cat# N2702-AF568-S, RRID:AB_3076052 Copy
http://antibodyregistry.org/AB_3674441
Comments: Applications: IP, Co-IP, MS
Host Organism: Alpaca
Clonality unknown
Target(s): HA-Tag (sequence YPYDVPDYA)
Proper citation: ChromoTek Cat# atak-iST, RRID:AB_3674441 Copy
http://antibodyregistry.org/AB_3665414
Comments: Applications: ELISA, BLI, SPR
Host Organism: alpaca
Clonality recombinant
Target(s): OSM
Proper citation: Proteintech Cat# osm-b, RRID:AB_3665414 Copy
http://antibodyregistry.org/AB_3076033
Comments: Applications: IF
Host Organism: Alpaca
Clonality monoclonal
Target(s): Synaptotagmin-1 cytosolic domain
Proper citation: NanoTag Biotechnologies Cat# N2302-AT643-L, RRID:AB_3076033 Copy
http://antibodyregistry.org/AB_3666926
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality recombinant monoclonal
Target(s): RECQL5 VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54678, RRID:AB_3666926 Copy
http://antibodyregistry.org/AB_3666617
Comments: Applications: Flow
Host Organism: Alpaca
Clonality recombinant monoclonal
Target(s): beta-2 Adrenergic Receptor VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54367, RRID:AB_3666617 Copy
http://antibodyregistry.org/AB_3076107
Comments: Applications: IF,IHC
Host Organism: Alpaca
Clonality monoclonal
Target(s): Recognizes mouse and rat PSD95. Other species not tested
Proper citation: NanoTag Biotechnologies Cat# N3705-250ug, RRID:AB_3076107 Copy
http://antibodyregistry.org/AB_3076020
Comments: Applications: IF, WB
Host Organism: Alpaca
Clonality monoclonal
Target(s): Mouse IgG1, does not cross-react with rabbit, guinea pig or chicken immunoglobulins
Proper citation: NanoTag Biotechnologies Cat# N2002-AF647-S, RRID:AB_3076020 Copy
http://antibodyregistry.org/AB_3666913
Comments: Applications: ELISA
Host Organism: Alpaca
Clonality recombinant monoclonal
Target(s): PTCH VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54665, RRID:AB_3666913 Copy
http://antibodyregistry.org/AB_3666807
Comments: Applications: ELISA, Functional
Host Organism: Alpaca
Clonality recombinant monoclonal
Target(s): EGFR VHH-8His-Cys-tag
Proper citation: Thermo Fisher Scientific Cat# MA5-54557, RRID:AB_3666807 Copy
http://antibodyregistry.org/AB_3076113
Comments: Applications: IF, IHC, WB
Host Organism: Alpaca
Clonality monoclonal
Target(s): Recognizes mouse and rat PSD95. Other species not tested
Proper citation: NanoTag Biotechnologies Cat# N3785, RRID:AB_3076113 Copy
http://antibodyregistry.org/AB_2894835
Comments: Applications: IP, CoIP, ChIP, RIP
Host Organism: alpaca
Clonality unknown
Target(s): Halo-Tag
Proper citation: ChromoTek Cat# otdk, RRID:AB_2894835 Copy
http://antibodyregistry.org/AB_2744616
Comments: Applications: IF
Host Organism: Alpaca
Clonality monoclonal
Target(s): GFP (green fluorescent protein) and common GFP derivatives like EGFP, mEGFP, Sirius, tSapphire, Cerulean, eCFP, mTurquoise, acGFP, Emerald, superecliptic pHluorin, paGFP, superfolder GFP, eYFP, mVenus and Citrine
Proper citation: NanoTag Biotechnologies Cat# N0301-AB635P-L, RRID:AB_2744616 Copy
http://antibodyregistry.org/AB_3674450
Comments: Applications: IP, Co-IP
Host Organism: Alpaca
Clonality unknown
Target(s): Strep-Tag® (sequence: SAWSHPQFEK) and Twin-Strep-Tag® (sequence: SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK)
Proper citation: ChromoTek Cat# qtak, RRID:AB_3674450 Copy
http://antibodyregistry.org/AB_2922852
Comments:
Host Organism: alpaca
Clonality polyclonal secondary
Target(s): IgG (H+L)
Proper citation: Jackson ImmunoResearch Labs Cat# 609-064-213, RRID:AB_2922852 Copy
http://antibodyregistry.org/AB_3076068
Comments: Applications: IF
Host Organism: Alpaca
Clonality monoclonal
Target(s): Recognizes mEOS and mEOS derivatives
Proper citation: NanoTag Biotechnologies Cat# N3105-DBCO, RRID:AB_3076068 Copy
http://antibodyregistry.org/AB_3075941
Comments: Applications: IF
Host Organism: Alpaca
Clonality monoclonal
Target(s): mTagBFP, mKate, mKate2, mTagRFP, mTagRFP657
Proper citation: NanoTag Biotechnologies Cat# N0505-DBCO, RRID:AB_3075941 Copy
http://antibodyregistry.org/AB_3075901
Comments: Applications: IF
Host Organism: Alpaca
Clonality monoclonal
Target(s): GFP (green fluorescent protein) and common GFP derivatives like EGFP, mEGFP, Sirius, tSapphire, Cerulean, eCFP, mTurquoise, acGFP, Emerald, superecliptic pHluorin, paGFP, superfolder GFP, eYFP, mVenus and Citrine
Proper citation: NanoTag Biotechnologies Cat# N0301-AT643-L, RRID:AB_3075901 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
