Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673598
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF219
Proper citation: Atlas Antibodies Cat# HPA030761, RRID:AB_2673598 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603129
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PM20D2
Proper citation: Atlas Antibodies Cat# HPA030327, RRID:AB_10603129 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602691
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF774
Proper citation: Atlas Antibodies Cat# HPA030840, RRID:AB_10602691 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601548
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): DZIP1L
Proper citation: Atlas Antibodies Cat# HPA030404, RRID:AB_10601548 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963060
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): FAM159A
Proper citation: Atlas Antibodies Cat# HPA030744, RRID:AB_10963060 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601716
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC35D3
Proper citation: Atlas Antibodies Cat# HPA030431, RRID:AB_10601716 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673514
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MARCKSL1
Proper citation: Atlas Antibodies Cat# HPA030528, RRID:AB_2673514 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599613
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARHGEF40
Proper citation: Atlas Antibodies Cat# HPA030746, RRID:AB_10599613 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673647
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPATS1
Proper citation: Atlas Antibodies Cat# HPA030897, RRID:AB_2673647 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673523
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IBA57
Proper citation: Atlas Antibodies Cat# HPA030556, RRID:AB_2673523 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601226
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SYTL3
Proper citation: Atlas Antibodies Cat# HPA030586, RRID:AB_10601226 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673584
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF667
Proper citation: Atlas Antibodies Cat# HPA030731, RRID:AB_2673584 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602421
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): METAP1D
Proper citation: Atlas Antibodies Cat# HPA030299, RRID:AB_10602421 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603342
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): STT3A
Proper citation: Atlas Antibodies Cat# HPA030735, RRID:AB_10603342 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600930
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MKL1
Proper citation: Atlas Antibodies Cat# HPA030782, RRID:AB_10600930 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673642
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): OSTN
Proper citation: Atlas Antibodies Cat# HPA030878, RRID:AB_2673642 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669597
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NCOA7
Proper citation: Atlas Antibodies Cat# HPA030291, RRID:AB_10669597 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2154066
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NT5DC1
Proper citation: Atlas Antibodies Cat# HPA030352, RRID:AB_2154066 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602102
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): YKT6
Proper citation: Atlas Antibodies Cat# HPA030818, RRID:AB_10602102 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603232
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RCHY1
Proper citation: Atlas Antibodies Cat# HPA030339, RRID:AB_10603232 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.