Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-PARD6B polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013376, RRID:AB_1854972 | PARD6B | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1854972 | Atlas Antibodies | HPA013376 | 2026-08-29 03:55:07 | 0 | ||
|
Anti-LPAR5 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013170, RRID:AB_1849314 | LPAR5 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1849314 | Atlas Antibodies | HPA013170 | 2026-08-31 04:10:21 | 0 | ||
|
Anti-GNRHR polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013424, RRID:AB_2668840 | GNRHR | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2668840 | Atlas Antibodies | HPA013424 | 2026-08-29 09:48:43 | 0 | ||
|
Anti-TGOLN2 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012609, RRID:AB_1857976 | TGOLN2 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1857976 | Atlas Antibodies | HPA012609 | 2026-08-31 05:08:46 | 0 | ||
|
Anti-MAGI2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013650, RRID:AB_1853501 | MAGI2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1853501 | Atlas Antibodies | HPA013650 | 2026-08-31 04:32:12 | 0 | ||
|
Anti-NLRP3 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA012878, RRID:AB_1846752 | NLRP3 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1846752 | Atlas Antibodies | HPA012878 | 2026-08-29 04:51:56 | 2 | ||
|
Anti-MPPE1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012639, RRID:AB_1854088 | MPPE1 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1854088 | Atlas Antibodies | HPA012639 | 2026-08-29 02:47:42 | 0 | ||
|
Anti-ILDR2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012545, RRID:AB_2126894 | ILDR2 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHSQPRSKSEMLSRKNFATGVPAVSMDELAAFADSYGQRPRRADGNSHEARGGSRFERSESRAHSGFYQDDSLEEYYGQRSRSREPLTDADR; Manufacturer approved use: IHC, WB | polyclonal | rabbit | AB_2126894 | Atlas Antibodies | HPA012545 | 2026-08-29 04:39:50 | 0 | ||
|
Anti-PDE4DIP polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012678, RRID:AB_1855123 | PDE4DIP | rat, mouse, human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1855123 | Atlas Antibodies | HPA012678 | 2026-08-31 12:37:29 | 0 | ||
|
Anti-HSPA12B polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA013659, RRID:AB_1234541 | HSPA12B | Human, Rat, Mouse | PMID:27641958 | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1234541 | Atlas Antibodies | HPA013659 | 2026-08-28 07:20:49 | 1 | |
|
Anti-TOR1B polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013403, RRID:AB_1858195 | TOR1B | rat, mouse, human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1858195 | Atlas Antibodies | HPA013403 | 2026-08-28 04:29:02 | 0 | ||
|
Anti-GPLD1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012500, RRID:AB_1849931 | GPLD1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1849931 | Atlas Antibodies | HPA012500 | 2026-08-29 09:03:00 | 0 | ||
|
Anti-KLHL8 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013856, RRID:AB_1852594 | KLHL8 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1852594 | Atlas Antibodies | HPA013856 | 2026-08-31 10:01:11 | 0 | ||
|
Anti-EPHX3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012842, RRID:AB_10601648 | EPHX3 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10601648 | Atlas Antibodies | HPA012842 | 2026-08-29 07:58:55 | 0 | ||
|
Anti-STMN3 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012947, RRID:AB_1857606 | STMN3 | human | Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1857606 | Atlas Antibodies | HPA012947 | 2026-08-31 09:26:45 | 0 | ||
|
Anti-CSF1R Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012323, RRID:AB_1848977 | CSF1R | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1848977 | Atlas Antibodies | HPA012323 | 2026-08-29 06:50:41 | 0 | ||
|
Anti-HLA-DOB polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013846, RRID:AB_1853928 | HLA-DOB | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1853928 | Atlas Antibodies | HPA013846 | 2026-08-31 11:23:24 | 0 | ||
|
Anti-FKBP9 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012595, RRID:AB_1848629 | FKBP9 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1848629 | Atlas Antibodies | HPA012595 | 2026-08-29 09:10:32 | 0 | ||
|
Anti-HLA-DQB1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA013667, RRID:AB_1853932 | HLA-DQB1 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1853932 | Atlas Antibodies | HPA013667 | 2026-08-29 01:28:41 | 0 | ||
|
Anti-BRWD3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012802, RRID:AB_2066662 | BRWD3 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQDESILDGIIRELQREQDLRLINEGDVPHLPVNRAYSVNGALRSPNMDISSSPNIRLRRHSSQIEGVRQMHNNAPRSQMATERDLMAWSRRVVVNELNNGVSRVQEE; Manufacturer approved use: ICC-IF, IHC | polyclonal | rabbit | AB_2066662 | Atlas Antibodies | HPA012802 | 2026-08-29 05:01:32 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
