Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681631
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TM4SF20
Proper citation: Atlas Antibodies Cat# HPA051838, RRID:AB_2681631 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681435
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): OR2M4
Proper citation: Atlas Antibodies Cat# HPA051308, RRID:AB_2681435 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681420
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRODH2
Proper citation: Atlas Antibodies Cat# HPA051287, RRID:AB_2681420 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681597
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UBE2A
Proper citation: Atlas Antibodies Cat# HPA051765, RRID:AB_2681597 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681485
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): OXER1
Proper citation: Atlas Antibodies Cat# HPA051433, RRID:AB_2681485 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681512
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TCEAL7
Proper citation: Atlas Antibodies Cat# HPA051507, RRID:AB_2681512 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681451
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATRAID
Proper citation: Atlas Antibodies Cat# HPA051353, RRID:AB_2681451 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681441
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CTPS1
Proper citation: Atlas Antibodies Cat# HPA051322, RRID:AB_2681441 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681457
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPRY1
Proper citation: Atlas Antibodies Cat# HPA051369, RRID:AB_2681457 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681634
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RBMXL2
Proper citation: Atlas Antibodies Cat# HPA051842, RRID:AB_2681634 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681534
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TTC13
Proper citation: Atlas Antibodies Cat# HPA051558, RRID:AB_2681534 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681610
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SOX13
Proper citation: Atlas Antibodies Cat# HPA051790, RRID:AB_2681610 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681500
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANXA2R
Proper citation: Atlas Antibodies Cat# HPA051482, RRID:AB_2681500 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681454
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLAMF6
Proper citation: Atlas Antibodies Cat# HPA051363, RRID:AB_2681454 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681606
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF300
Proper citation: Atlas Antibodies Cat# HPA051777, RRID:AB_2681606 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681413
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MRPL4
Proper citation: Atlas Antibodies Cat# HPA051261, RRID:AB_2681413 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681503
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC26A9
Proper citation: Atlas Antibodies Cat# HPA051485, RRID:AB_2681503 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681647
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CHTF8
Proper citation: Atlas Antibodies Cat# HPA051872, RRID:AB_2681647 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681622
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AGSDSNERDSTKEDNVAPLRFHLKYEADVLFTRSSSLSHYEVKLNSSLERYDGIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): ITGA11
Proper citation: Atlas Antibodies Cat# HPA051813, RRID:AB_2681622 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681531
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GCPMVLAPCSDSRQQQYLQHTSRKEIHFGSPQHLCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGKCMEAVVQENNKDLYLRPCDGKARQQWRFDQINAVDE; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): GALNT15
Proper citation: Atlas Antibodies Cat# HPA051551, RRID:AB_2681531 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.