Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2669216
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MORC4
Proper citation: Atlas Antibodies Cat# HPA015547, RRID:AB_2669216 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2164679
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PIGG
Proper citation: Atlas Antibodies Cat# HPA015997, RRID:AB_2164679 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849219
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ACKR1
Proper citation: Atlas Antibodies Cat# HPA016421, RRID:AB_1849219 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845121
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SGDKDIPAINQGLILEETPESSFLIEGDIIRPSPFRLLSATSNKWPMGGSGVVEVPFLLSSKYDEPSRQVILEALAEFERSTCIRFVTYQDQRDFISIIPMYGCFSSVGRSGGMQVVSLAPTCLQK; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): ASTL
Proper citation: Atlas Antibodies Cat# HPA015620, RRID:AB_1845121 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849905
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GP2
Proper citation: Atlas Antibodies Cat# HPA015739, RRID:AB_1849905 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845414
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BPGM
Proper citation: Atlas Antibodies Cat# HPA016493, RRID:AB_1845414 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852955
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LMLN
Proper citation: Atlas Antibodies Cat# HPA016481, RRID:AB_1852955 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858027
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): TLK1
Proper citation: Atlas Antibodies Cat# HPA016043, RRID:AB_1858027 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857899
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): TES
Proper citation: Atlas Antibodies Cat# HPA015269, RRID:AB_1857899 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858913
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KKKRLAKNRSRDGTKDSCPLNGHLQHCLETVREEFIIFNREKLRRQQGQGSQLLDTDSRGGGQAQSKLQDGCNNNLLTHTCTRGC; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): STK32B
Proper citation: Atlas Antibodies Cat# HPA015820, RRID:AB_1858913 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844942
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): APOBEC4
Proper citation: Atlas Antibodies Cat# HPA015636, RRID:AB_1844942 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858069
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEFF2
Proper citation: Atlas Antibodies Cat# HPA015587, RRID:AB_1858069 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858812
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): WDR53
Proper citation: Atlas Antibodies Cat# HPA016420, RRID:AB_1858812 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847604
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PREX2
Proper citation: Atlas Antibodies Cat# HPA015234, RRID:AB_1847604 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2304947
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF532
Proper citation: Atlas Antibodies Cat# HPA015322, RRID:AB_2304947 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854992
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PASK
Proper citation: Atlas Antibodies Cat# HPA016450, RRID:AB_1854992 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859103
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RNF112
Proper citation: Atlas Antibodies Cat# HPA015970, RRID:AB_1859103 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846731
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CHST8
Proper citation: Atlas Antibodies Cat# HPA016004, RRID:AB_1846731 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857617
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ACHDQFPDEFLDAICSNLSFSALSGSNRRLVKRLCAGLLPPPTSCPEGLPPVPLTPDIFWGCFLENETLWAERLCGEASLQAVPPSNQAWVQHVCQGPTPDVTASPPCHIGPCGERCPDGGSFLVMVCAND; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): STRC
Proper citation: Atlas Antibodies Cat# HPA015731, RRID:AB_1857617 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845355
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SH3GLB1
Proper citation: Atlas Antibodies Cat# HPA015608, RRID:AB_1845355 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
