Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856823
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPEN
Proper citation: Atlas Antibodies Cat# HPA015825, RRID:AB_1856823 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853917
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GRM1
Proper citation: Atlas Antibodies Cat# HPA015701, RRID:AB_1853917 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848405
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM69A
Proper citation: Atlas Antibodies Cat# HPA015718, RRID:AB_1848405 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855090
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDK17
Proper citation: Atlas Antibodies Cat# HPA015325, RRID:AB_1855090 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856540
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ADCY10
Proper citation: Atlas Antibodies Cat# HPA015243, RRID:AB_1856540 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848482
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEENYENV; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): FCRL3
Proper citation: Atlas Antibodies Cat# HPA015508, RRID:AB_1848482 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845406
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BNIP3L
Proper citation: Atlas Antibodies Cat# HPA015652, RRID:AB_1845406 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858083
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM126B
Proper citation: Atlas Antibodies Cat# HPA014480, RRID:AB_1858083 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852114
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KCNF1
Proper citation: Atlas Antibodies Cat# HPA014738, RRID:AB_1852114 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855451
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PKP2
Proper citation: Atlas Antibodies Cat# HPA014314, RRID:AB_1855451 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854745
Comments: Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MBOAT2
Proper citation: Atlas Antibodies Cat# HPA014836, RRID:AB_1854745 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847039
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CNN1
Proper citation: Atlas Antibodies Cat# HPA014263, RRID:AB_1847039 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2158172
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): OPALIN
Proper citation: Atlas Antibodies Cat# HPA014372, RRID:AB_2158172 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847370
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CYB5R1
Proper citation: Atlas Antibodies Cat# HPA014147, RRID:AB_1847370 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2190374
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC37A2
Proper citation: Atlas Antibodies Cat# HPA014948, RRID:AB_2190374 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853243
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ADGRL3
Proper citation: Atlas Antibodies Cat# HPA015027, RRID:AB_1853243 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845504
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BVES
Proper citation: Atlas Antibodies Cat# HPA014788, RRID:AB_1845504 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846639
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCR6
Proper citation: Atlas Antibodies Cat# HPA014488, RRID:AB_1846639 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853084
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): DRAXIN
Proper citation: Atlas Antibodies Cat# HPA014302, RRID:AB_1853084 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846265
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MS4A1
Proper citation: Atlas Antibodies Cat# HPA014341, RRID:AB_1846265 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.