Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-TKFC Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA039486, RRID:AB_10795402 | TKFC | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_10795402 | Atlas Antibodies | HPA039486 | 2025-08-19 10:11:03 | 0 | ||
|
Anti-CCDC185 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA027518, RRID:AB_1848895 | CCDC185 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EEEQLQQARWRAGESEEQRKMRKRILVELADEKIRQARSHVHKTTRDKVQHLRELNHLREKNHHILKLKAEKEEKCHIEGIKEAIKKKEQRVQHISQGKD; Manufacturer approved use: IHC | polyclonal | rabbit | AB_1848895 | Atlas Antibodies | HPA027518 | 2025-08-19 10:11:05 | 0 | ||
|
Anti-JAKMIP3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA022872, RRID:AB_2249331 | JAKMIP3 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2249331 | Atlas Antibodies | HPA022872 | 2025-08-19 10:11:02 | 0 | ||
|
Anti-SMARCC1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA024352, RRID:AB_1857274 | SMARCC1 | rat, mouse, human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1857274 | Atlas Antibodies | HPA024352 | 2025-08-19 10:11:41 | 0 | ||
|
Anti-C1D polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA037413, RRID:AB_2675463 | C1D | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2675463 | Atlas Antibodies | HPA037413 | 2025-08-19 10:11:25 | 0 | ||
|
Anti-TMEM45A polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA062101, RRID:AB_2684682 | TMEM45A | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2684682 | Atlas Antibodies | HPA062101 | 2025-08-19 10:11:25 | 0 | ||
|
Anti-ALPK2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA027377, RRID:AB_10600635 | ALPK2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10600635 | Atlas Antibodies | HPA027377 | 2025-08-19 10:11:41 | 0 | ||
|
Anti-OSBPL7 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA053083, RRID:AB_2682038 | OSBPL7 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682038 | Atlas Antibodies | HPA053083 | 2025-08-19 10:11:43 | 0 | ||
|
Anti-A2ML1 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA038847, RRID:AB_2676236 | A2ML1 | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2676236 | Atlas Antibodies | HPA038847 | 2025-08-19 10:11:25 | 0 | ||
|
Rabbit Anti-Human CHD1 Polyclonal Antibody, Unconjugated Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Thermo Fisher Scientific Cat# A301-218A, RRID:AB_890568 | CHD1 | human | Discontinued; Applications: IP (2-5 µg/mg lysate), WB (1:2,000-1:10,000), ChIP-seq (10 µL/IP), ChIP (see datasheet) | polyclonal | rabbit | AB_890568 | Thermo Fisher Scientific | A301-218A | 2025-08-19 10:11:52 | 4 | ||
|
Anti-FKBP1B Antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA045572, RRID:AB_2732521 | FKBP1B | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2732521 | Atlas Antibodies | HPA045572 | 2025-08-19 10:11:47 | 0 | ||
|
Anti-TMEM240 Antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA066721, RRID:AB_2732750 | TMEM240 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2732750 | Atlas Antibodies | HPA066721 | 2025-08-19 10:11:47 | 0 | ||
|
Anti-HEPACAM2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012381, RRID:AB_1853037 | HEPACAM2 | human | polyclonal | rabbit | AB_1853037 | Atlas Antibodies | HPA012381 | 2025-08-19 10:11:42 | 0 | |||
|
Anti-NFKBIL1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006298, RRID:AB_1079480 | NFKBIL1 | human | polyclonal | rabbit | AB_1079480 | Atlas Antibodies | HPA006298 | 2025-08-19 10:11:54 | 0 | |||
|
Anti-CASP8 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA008936, RRID:AB_1846058 | CASP8 | human | polyclonal | rabbit | AB_1846058 | Atlas Antibodies | HPA008936 | 2025-08-19 10:11:54 | 0 | |||
|
Anti-LRG1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA001889, RRID:AB_1079275 | LRG1 antibody produced in rabbit | human | Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1079275 | Sigma-Aldrich | HPA001889 | 2025-08-19 10:05:47 | 0 | ||
|
Anti-DNAI1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA021649, RRID:AB_1847913 | Human DNAI1 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847913 | Sigma-Aldrich | HPA021649 | 2025-08-19 10:05:49 | 0 | ||
|
Anti-DQX1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA039158, RRID:AB_10960125 | DQX1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10960125 | Sigma-Aldrich | HPA039158 | 2025-08-19 10:06:09 | 0 | |||
|
Anti-WFDC10B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA014046, RRID:AB_10965988 | WFDC10B antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10965988 | Sigma-Aldrich | HPA014046 | 2025-08-19 10:06:05 | 0 | |||
|
Anti-AMOTL1 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA001196, RRID:AB_1078147 | AMOTL1 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1078147 | Sigma-Aldrich | HPA001196 | 2025-08-19 10:06:31 | 2 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
