Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Host Organism:rabbit (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

1,488,197 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-OR2D3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052551, RRID:AB_2681867 OR2D3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681867 Atlas Antibodies HPA052551 2025-08-19 10:32:13 0
Anti-AC092329.1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA042724, RRID:AB_10793983 AC092329.1 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_10793983 Sigma-Aldrich HPA042724 2025-08-19 10:32:10 0
Med15 (H-178)
 
Resource Report
Resource Website
Santa Cruz Biotechnology Cat# sc-292267, RRID:AB_10845917 Med15 (H-178) rat, mouse, human validation status unknown check with seller; recommendations: WB, IP, IF, ELISA; Immunofluorescence; Immunoprecipitation; ELISA; Western Blot monoclonal rabbit AB_10845917 Santa Cruz Biotechnology sc-292267 2025-08-19 10:32:17 0
Rabbit Anti-SMAD6 Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
Abnova Cat# PAB9107, RRID:AB_1714291 SMAD6 manufacturer recommendations: Western Blot; Western Blot-Ce polyclonal rabbit AB_1714291 Abnova PAB9107 2025-08-19 10:32:21 0
Rabbit Anti-human K-chain Secondary Antibody, APC Conjugated
 
Resource Report
Resource Website
Bioss Cat# bsA-8-APC, RRID:AB_10893730 Rabbit human K-chain Secondary APC human manufacturer recommendations: IF, Flow-Cyt polyclonal rabbit AB_10893730 Bioss bsA-8-APC 2025-08-19 10:31:53 0
Exostosin-1 Antibody
 
Resource Report
Resource Website
Abbiotec Cat# 200137, RRID:AB_2102114 ext1b mouse, zebrafish, human Useful for ELISA polyclonal rabbit AB_2102114 Abbiotec 200137 2025-08-19 10:32:17 0
EML3 antibody
 
Resource Report
Resource Website
Fitzgerald Industries International Cat# 70R-4256, RRID:AB_10811829 EML3 antibody mouse, human manufacturer recommendations: Western Blot; WB polyclonal rabbit AB_10811829 Fitzgerald Industries International 70R-4256 2025-08-19 10:31:52 0
anti-Ubiquitin Carboxyl-terminal Hydrolase CYLD (CYLD) antibody
 
Resource Report
Resource Website
Antibodies-Online Cat# ABIN461715, RRID:AB_10827086 anti-Ubiquitin Carboxyl-terminal Hydrolase CYLD (CYLD) antibody human manufacturer recommendations: Immunocytochemistry (ICC),Western Blotting (WB),Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)),Agonist (Agon); Immunocytochemistry; Western Blot; Immunohistochemistry polyclonal rabbit AB_10827086 Antibodies-Online ABIN461715 2025-08-19 10:32:15 0
IL13RA2 Polyclonal Antibody
 
Resource Report
Resource Website
ABclonal Cat# A2043, RRID:AB_2764067 IL13RA2 rat, mouse, human Applications:WB polyclonal rabbit AB_2764067 ABclonal A2043 2025-08-19 10:31:54 0
IKAP Antibody
 
Resource Report
Resource Website
ProSci Cat# 2337, RRID:AB_735427 IKAP h, m, mouse, human manufacturer recommendations: ELISA; Immunocytochemistry; Western Blot; IKAP antibody can be used for detection of IKAP by Western blot at 0.5 to 1 & 956;g/mL. E, WB, ICC unknown rabbit AB_735427 ProSci 2337 2025-08-19 10:32:21 0
HCRTR1 Polyclonal Antibody
 
Resource Report
Resource Website
ABclonal Cat# A9349, RRID:AB_2769749 HCRTR1 human Applications: WB polyclonal rabbit AB_2769749 ABclonal A9349 2025-08-19 10:31:55 0
Rabbit Anti-FIS1 Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
Abnova Cat# PAB8718, RRID:AB_1674968 FIS1 manufacturer recommendations: Immunofluorescence; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot polyclonal rabbit AB_1674968 Abnova PAB8718 2025-08-19 10:32:18 0
SAA4 antibody
 
Resource Report
Resource Website
Fitzgerald Industries International Cat# 70R-5924, RRID:AB_10813074 SAA4 antibody human manufacturer recommendations: Western Blot; WB polyclonal rabbit AB_10813074 Fitzgerald Industries International 70R-5924 2025-08-19 10:31:52 0
anti-CD9 (CD9) antibody
 
Resource Report
Resource Website
Antibodies-Online Cat# ABIN213766, RRID:AB_10823958 anti-CD9 (CD9) antibody human manufacturer recommendations: Western Blot; Immunohistochemistry; Western Blotting (WB),Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) polyclonal rabbit AB_10823958 Antibodies-Online ABIN213766 2025-08-19 10:32:14 0
Rabbit Anti-FGFR1 Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
Abnova Cat# PAB11876, RRID:AB_1675067 FGFR1 manufacturer recommendations: Immunohistochemistry; Immunohistochemistry-P polyclonal rabbit AB_1675067 Abnova PAB11876 2025-08-19 10:32:18 0
PAX6 antibody [EPR3352(2)]
 
Resource Report
Resource Website
1+ mentions
Abcam Cat# ab109233, RRID:AB_10861257 PAX6 antibody [EPR3352(2)] rat, mouse, human validation status unknown, seller recommendations provided in 2012: Flow Cytometry; Western Blot; Flow Cyt, WB monoclonal rabbit AB_10861257 Abcam ab109233 2025-08-19 10:32:21 2
Anti-TBC1D3L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052553, RRID:AB_2681869 TBC1D3L human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681869 Atlas Antibodies HPA052553 2025-08-19 10:32:13 0
Rabbit Anti-CD282 / TLR2 Antibody, Unconjugated
 
Resource Report
Resource Website
Acris Antibodies Cat# AP09340PU-N, RRID:AB_2035301 CD282 / TLR2 mouse, human manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; ELISA, Paraffin sections, Western Blot unknown rabbit AB_2035301 Acris Antibodies AP09340PU-N 2025-08-19 10:31:55 0
Anti-CFAP77 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024647, RRID:AB_10601126 CFAP77 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMN; Manufacturer approved use: IHC polyclonal rabbit AB_10601126 Atlas Antibodies HPA024647 2025-08-19 10:32:11 0
Rabbit Anti-ErbB-2 (Her-2), phospho (Tyr1248) Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
AnaSpec; EGT Group Cat# 29607-025, RRID:AB_1091590 ErbB-2 (Her-2), phospho (Tyr1248) mouse, human manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; Immunohistochemistry, Western Blot, ELISA polyclonal rabbit AB_1091590 AnaSpec; EGT Group 29607-025 2025-08-19 10:31:50 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.