Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10903230
Comments: validation status unknown, seller recommendations provided in 2012: Immunocytochemistry; Immunohistochemistry - fixed; Western Blot; Flow Cytometry; Immunohistochemistry; Flow Cyt, ICC, IHC-P, WB
Host Organism: rabbit
Clonality monoclonal
Target(s): Glucose Transporter GLUT1 antibody [EPR3915]
Proper citation: Abcam Cat# ab115730, RRID:AB_10903230 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080009
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human SLC44A2
Proper citation: Sigma-Aldrich Cat# HPA003228, RRID:AB_1080009 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_309852
Comments: seller recommendations: IgG1; IgG1 ChIP, WB; Western Blot; ChIP
Host Organism: mouse
Clonality monoclonal
Target(s): RNA polymerase II clone CTD4H8
Proper citation: Millipore Cat# 05-623, RRID:AB_309852 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853842
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human MFAP3L
Proper citation: Sigma-Aldrich Cat# HPA017986, RRID:AB_1853842 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845353
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human BICD2
Proper citation: Sigma-Aldrich Cat# HPA024452, RRID:AB_1845353 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960703
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): RPS13 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA005985, RRID:AB_10960703 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844444
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ABCG8
Proper citation: Atlas Antibodies Cat# HPA019556, RRID:AB_1844444 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959761
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): AP000679.2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA046251, RRID:AB_10959761 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845583
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VPS9D1
Proper citation: Atlas Antibodies Cat# HPA023620, RRID:AB_1845583 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846832
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CKAP2
Proper citation: Atlas Antibodies Cat# HPA008410, RRID:AB_1846832 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847884
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DUSP12
Proper citation: Atlas Antibodies Cat# HPA008840, RRID:AB_1847884 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846639
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCR6
Proper citation: Atlas Antibodies Cat# HPA014488, RRID:AB_1846639 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2066662
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQDESILDGIIRELQREQDLRLINEGDVPHLPVNRAYSVNGALRSPNMDISSSPNIRLRRHSSQIEGVRQMHNNAPRSQMATERDLMAWSRRVVVNELNNGVSRVQEE; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): BRWD3
Proper citation: Atlas Antibodies Cat# HPA012802, RRID:AB_2066662 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854906
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human NCF2
Proper citation: Sigma-Aldrich Cat# HPA006040, RRID:AB_1854906 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1842670
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 11146-1D12 for not specified; status is not pursued
Host Organism: mouse
Clonality monoclonal
Target(s): NFX1
Proper citation: Sigma-Aldrich Cat# WH0004799M1, RRID:AB_1842670 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854813
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human OSBP2
Proper citation: Sigma-Aldrich Cat# HPA021514, RRID:AB_1854813 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732632
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PRRT1
Proper citation: Atlas Antibodies Cat# HPA059099, RRID:AB_2732632 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079355
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): YYY4
Proper citation: Atlas Antibodies Cat# HPA003532, RRID:AB_1079355 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671225
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): OCA2 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA036403, RRID:AB_10671225 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1050098
Comments: Applications: Western Blot, Immunoprecipitation
ENCODE PROJECT External validation DATA SET is released testing lot A1 for K562,HepG2,MCF-7,A549,HeLa-S3,GM12878; status is eligible for new data,awaiting lab characterization
Host Organism: Rabbit
Clonality polyclonal
Target(s): ZC3H11A
Proper citation: Novus Cat# NB100-74650, RRID:AB_1050098 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
