Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Glucose Transporter GLUT1 antibody [EPR3915] Resource Report Resource Website 10+ mentions Rating or validation data |
Abcam Cat# ab115730, RRID:AB_10903230 | Glucose Transporter GLUT1 antibody [EPR3915] | rat, mouse, human | validation status unknown, seller recommendations provided in 2012: Immunocytochemistry; Immunohistochemistry - fixed; Western Blot; Flow Cytometry; Immunohistochemistry; Flow Cyt, ICC, IHC-P, WB | monoclonal | rabbit | AB_10903230 | Abcam | ab115730 | 2025-08-19 09:14:52 | 44 | ||
|
Anti-SLC44A2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA003228, RRID:AB_1080009 | Human SLC44A2 | human | Vendor recommendations: | unknown | rabbit | AB_1080009 | Sigma-Aldrich | HPA003228 | 2025-08-19 09:14:49 | 0 | ||
|
Anti-RNA polymerase II, clone CTD4H8 Resource Report Resource Website 10+ mentions Rating or validation data |
Millipore Cat# 05-623, RRID:AB_309852 | RNA polymerase II clone CTD4H8 | h, m, yeastfungi, r | seller recommendations: IgG1; IgG1 ChIP, WB; Western Blot; ChIP | monoclonal | mouse | AB_309852 | Millipore | 05-623 | 2025-08-19 09:14:23 | 34 | ||
|
Anti-MFAP3L antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA017986, RRID:AB_1853842 | Human MFAP3L | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1853842 | Sigma-Aldrich | HPA017986 | 2025-08-19 09:14:56 | 0 | ||
|
Anti-BICD2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA024452, RRID:AB_1845353 | Human BICD2 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1845353 | Sigma-Aldrich | HPA024452 | 2025-08-19 09:14:30 | 0 | ||
|
Anti-RPS13 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA005985, RRID:AB_10960703 | RPS13 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10960703 | Sigma-Aldrich | HPA005985 | 2025-08-19 09:15:02 | 0 | |||
|
Anti-ABCG8 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA019556, RRID:AB_1844444 | ABCG8 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1844444 | Atlas Antibodies | HPA019556 | 2025-08-19 09:14:32 | 0 | ||
|
Anti-AP000679.2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA046251, RRID:AB_10959761 | AP000679.2 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10959761 | Sigma-Aldrich | HPA046251 | 2025-08-19 09:15:01 | 0 | |||
|
Anti-VPS9D1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA023620, RRID:AB_1845583 | VPS9D1 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845583 | Atlas Antibodies | HPA023620 | 2025-08-19 09:14:31 | 0 | ||
|
Anti-CKAP2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA008410, RRID:AB_1846832 | CKAP2 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1846832 | Atlas Antibodies | HPA008410 | 2025-08-19 09:14:39 | 0 | ||
|
Anti-DUSP12 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA008840, RRID:AB_1847884 | DUSP12 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1847884 | Atlas Antibodies | HPA008840 | 2025-08-19 09:14:51 | 0 | ||
|
Anti-CCR6 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA014488, RRID:AB_1846639 | CCR6 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1846639 | Atlas Antibodies | HPA014488 | 2025-08-19 09:16:16 | 0 | ||
|
Anti-BRWD3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA012802, RRID:AB_2066662 | BRWD3 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQDESILDGIIRELQREQDLRLINEGDVPHLPVNRAYSVNGALRSPNMDISSSPNIRLRRHSSQIEGVRQMHNNAPRSQMATERDLMAWSRRVVVNELNNGVSRVQEE; Manufacturer approved use: ICC-IF, IHC | polyclonal | rabbit | AB_2066662 | Atlas Antibodies | HPA012802 | 2025-08-19 09:16:12 | 0 | ||
|
Anti-NCF2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA006040, RRID:AB_1854906 | Human NCF2 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1854906 | Sigma-Aldrich | HPA006040 | 2025-08-19 09:16:44 | 0 | ||
|
NFX1-human Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# WH0004799M1, RRID:AB_1842670 | NFX1 | homo sapiens | Clone 1D12 | ENCODE PROJECT External validation DATA SET is released testing lot 11146-1D12 for not specified; status is not pursued | monoclonal | mouse | AB_1842670 | Sigma-Aldrich | WH0004799M1 | 2025-08-19 09:17:27 | 0 | |
|
Anti-OSBP2 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA021514, RRID:AB_1854813 | Human OSBP2 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1854813 | Sigma-Aldrich | HPA021514 | 2025-08-19 09:17:28 | 2 | ||
|
Anti-PRRT1 Antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA059099, RRID:AB_2732632 | PRRT1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2732632 | Atlas Antibodies | HPA059099 | 2025-08-19 09:17:45 | 0 | ||
|
Rabbit Anti-Human YYY4, Unconjugated Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA003532, RRID:AB_1079355 | YYY4 | human | unknown | rabbit | AB_1079355 | Atlas Antibodies | HPA003532 | 2025-08-19 09:17:05 | 0 | |||
|
Anti-OCA2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA036403, RRID:AB_10671225 | OCA2 antibody produced in rabbit | human | polyclonal | rabbit | AB_10671225 | Atlas Antibodies | HPA036403 | 2025-08-19 09:17:05 | 0 | |||
|
ZC3H11A Antibody Resource Report Resource Website Rating or validation data |
Novus Cat# NB100-74650, RRID:AB_1050098 | ZC3H11A | Human |
Applications: Western Blot, Immunoprecipitation ENCODE PROJECT External validation DATA SET is released testing lot A1 for K562,HepG2,MCF-7,A549,HeLa-S3,GM12878; status is eligible for new data,awaiting lab characterization |
polyclonal | Rabbit | AB_1050098 | Novus | NB100-74650 | 2025-08-19 09:10:36 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
