Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854232
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human MYBPC1
Proper citation: Sigma-Aldrich Cat# HPA021004, RRID:AB_1854232 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2336026
Comments: Used By NYUIHC-18
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND
Proper citation: Innovative Research Cat# 3-Jul, RRID:AB_2336026 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684449
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SCOC
Proper citation: Atlas Antibodies Cat# HPA061198, RRID:AB_2684449 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_625300
Comments: Applications: WB, IP
Host Organism: rabbit
Clonality polyclonal
Target(s): Pescadillo
Proper citation: Bethyl Cat# A300-903A, RRID:AB_625300 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2671383
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF583
Proper citation: Atlas Antibodies Cat# HPA023957, RRID:AB_2671383 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080725
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF443
Proper citation: Atlas Antibodies Cat# HPA003150, RRID:AB_1080725 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676329
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNEL; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): DNAH10
Proper citation: Atlas Antibodies Cat# HPA039065, RRID:AB_2676329 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616000
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 20130115.RAP for not specified; status is not pursued
Host Organism: mouse
Clonality unknown
Target(s): HES1
Proper citation: CDI Cat# R159.1.2C1, RRID:AB_2616000 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079550
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NCF2
Proper citation: Atlas Antibodies Cat# HPA002327, RRID:AB_1079550 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079259
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LMTK2
Proper citation: Atlas Antibodies Cat# HPA010657, RRID:AB_1079259 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602251
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TOR3A
Proper citation: Atlas Antibodies Cat# HPA028766, RRID:AB_10602251 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794880
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FLYWCH1
Proper citation: Atlas Antibodies Cat# HPA040753, RRID:AB_10794880 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857403
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SP140
Proper citation: Atlas Antibodies Cat# HPA006162, RRID:AB_1857403 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678450
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PRND
Proper citation: Atlas Antibodies Cat# HPA043373, RRID:AB_2678450 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684842
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VIPR2
Proper citation: Atlas Antibodies Cat# HPA062707, RRID:AB_2684842 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795614
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HIC1
Proper citation: Atlas Antibodies Cat# HPA043372, RRID:AB_10795614 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685343
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OAT
Proper citation: Atlas Antibodies Cat# HPA064742, RRID:AB_2685343 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679584
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GRTP1
Proper citation: Atlas Antibodies Cat# HPA046201, RRID:AB_2679584 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678137
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LARP4B
Proper citation: Atlas Antibodies Cat# HPA042738, RRID:AB_2678137 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_669696
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 1 for not specified; status is not pursued
Host Organism: rabbit
Clonality unknown
Target(s): DDX28
Proper citation: Bethyl Cat# A300-761A, RRID:AB_669696 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.