Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669519
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM204A
Proper citation: Atlas Antibodies Cat# HPA038182, RRID:AB_10669519 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080303
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TM9SF2
Proper citation: Atlas Antibodies Cat# HPA005657, RRID:AB_1080303 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673927
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CXorf58
Proper citation: Atlas Antibodies Cat# HPA031542, RRID:AB_2673927 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616168
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 1 for K562; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): EXOSC5
Proper citation: MBL International Cat# RN100PW, RRID:AB_2616168 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680335
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GALK2
Proper citation: Atlas Antibodies Cat# HPA048267, RRID:AB_2680335 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849298
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GPR39
Proper citation: Atlas Antibodies Cat# HPA022111, RRID:AB_1849298 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795031
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): USP6NL
Proper citation: Atlas Antibodies Cat# HPA039196, RRID:AB_10795031 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_518533
Comments: Discontinued: 2014; manufacturer recommendations: Immunohistochemistry; Immunohistochemistry
Host Organism: rabbit
Clonality unknown
Target(s): Pancreatic Polypeptide (human) - Undiluted Antiserum for Immunohistochemistry Host: Rabbit
Proper citation: Peninsula Laboratories Cat# T-4088.0050, RRID:AB_518533 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859549
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): AP000569.1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA019164, RRID:AB_1859549 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603457
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TSR2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030514, RRID:AB_10603457 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599415
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): VPS45 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027425, RRID:AB_10599415 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10793969
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ANO3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041629, RRID:AB_10793969 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795486
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): AC084199.1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041033, RRID:AB_10795486 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845685
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ROMO1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA012782, RRID:AB_1845685 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616025
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 2 for HepG2,MCF-7,HEK293T,K562; status is pending dcc review,awaiting lab characterization
Host Organism: rabbit
Clonality monoclonal
Target(s): ATF4
Proper citation: Cell Signaling Technology Cat# 11815, RRID:AB_2616025 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856792
Comments: Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): SFXN4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA018028, RRID:AB_1856792 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335632
Comments: Used By NYUIHC-1407
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): e4E
Proper citation: Bioss Cat# bs-4979R, RRID:AB_2335632 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335958
Comments: Used By NYUIHC-1152
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND
Proper citation: Ventana Medical Systems Cat# 760-2624, RRID:AB_2335958 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_805802
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): MOF/MYST1
Proper citation: Bethyl Cat# A300-992A, RRID:AB_805802 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855573
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHETAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQL; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): KCNA10
Proper citation: Atlas Antibodies Cat# HPA015061, RRID:AB_1855573 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
