Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855631
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PPM1L
Proper citation: Atlas Antibodies Cat# HPA019891, RRID:AB_1855631 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615947
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 20140826.DNF for any cell type or tissues; status is awaiting lab characterization
Host Organism: mouse
Clonality unknown
Target(s): ZNF232
Proper citation: CDI Cat# R693.1.2G7, RRID:AB_2615947 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796215
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): DYDC1
Proper citation: Atlas Antibodies Cat# HPA037791, RRID:AB_10796215 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681547
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FRAS1
Proper citation: Atlas Antibodies Cat# HPA051601, RRID:AB_2681547 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681794
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): EFL1
Proper citation: Atlas Antibodies Cat# HPA052345, RRID:AB_2681794 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672551
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): COQ8B
Proper citation: Atlas Antibodies Cat# HPA028303, RRID:AB_2672551 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847925
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DYRK2
Proper citation: Atlas Antibodies Cat# HPA027230, RRID:AB_1847925 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679896
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PSMB8
Proper citation: Atlas Antibodies Cat# HPA046995, RRID:AB_2679896 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1147764
Comments: manufacturer recommendations: IgG WB; Western Blot; ELISA
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): JMJD3 (jumonji domain containing 3 histone lysine demethylase) (against the middle region of JMJD3) (100ug)
Proper citation: Aviva Systems Biology Cat# ARP40102_T100, RRID:AB_1147764 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794991
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): C20orf195 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041341, RRID:AB_10794991 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848496
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): FER1L5
Proper citation: Atlas Antibodies Cat# HPA010786, RRID:AB_1848496 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684656
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATP6V1F
Proper citation: Atlas Antibodies Cat# HPA062011, RRID:AB_2684656 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682832
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RRAGC
Proper citation: Atlas Antibodies Cat# HPA055489, RRID:AB_2682832 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680396
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SH3RF3
Proper citation: Atlas Antibodies Cat# HPA048444, RRID:AB_2680396 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672225
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ABHD14B
Proper citation: Atlas Antibodies Cat# HPA036642, RRID:AB_10672225 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848520
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FGD6
Proper citation: Atlas Antibodies Cat# HPA007974, RRID:AB_1848520 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683365
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SCPEP1
Proper citation: Atlas Antibodies Cat# HPA057200, RRID:AB_2683365 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684615
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MVLQAIEPRITLRGTDHFWRPAAQFESARGVTLFPDIKIVSTFAKTEAPGDVKTTDPKSEVLEEMLHNLDFCDILVIGGDLDPRQECL; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): CLSTN2
Proper citation: Atlas Antibodies Cat# HPA061800, RRID:AB_2684615 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10675799
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ADCY2
Proper citation: Atlas Antibodies Cat# HPA038483, RRID:AB_10675799 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683672
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SUSD4
Proper citation: Atlas Antibodies Cat# HPA058296, RRID:AB_2683672 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.