Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2101087
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): FAM117A
Proper citation: Sigma-Aldrich Cat# HPA022531, RRID:AB_2101087 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599302
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): OTUD3
Proper citation: Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1227812
Comments: Applications: FC
Host Organism: mouse
Clonality monoclonal
Target(s): TRA-1-60-R
Proper citation: BioLegend Cat# 330606, RRID:AB_1227812 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686301
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SYF2
Proper citation: Atlas Antibodies Cat# HPA070710, RRID:AB_2686301 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2620299
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): SF3B4
Proper citation: Bethyl Cat# A303-950A, RRID:AB_2620299 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2716760
Comments: for immunohistochemical staining of formalin-fixed, paraffin-embedded tissue sections.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): Glucagon
Proper citation: Ventana Medical Systems Cat# 760-2644, RRID:AB_2716760 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_371881
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 15084 for not specified; status is not pursued
Host Organism: mouse
Clonality monoclonal
Target(s): ID3
Proper citation: GeneTex Cat# GTX70201, RRID:AB_371881 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853404
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human LXN
Proper citation: Sigma-Aldrich Cat# HPA014179, RRID:AB_1853404 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_397666
Comments: Flow cytometry, Functional assay
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND
Proper citation: BD Biosciences Cat# 610271, RRID:AB_397666 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848256
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunofluorescence; Immunohistochemistry; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): PDIA4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA006139, RRID:AB_1848256 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669862
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF839 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA020434, RRID:AB_10669862 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10615370
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40163 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): CIZ1
Proper citation: GeneTex Cat# GTX102144, RRID:AB_10615370 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794739
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CKAP5 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040375, RRID:AB_10794739 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795524
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): KLC2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040416, RRID:AB_10795524 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078341
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human C1orf43
Proper citation: Sigma-Aldrich Cat# HPA010725, RRID:AB_1078341 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794418
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): SMCR7 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042334, RRID:AB_10794418 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11125735
Comments: Applications: WB, IP
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): HLX
Proper citation: Bethyl Cat# A303-584A, RRID:AB_11125735 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845121
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ASTL antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015620, RRID:AB_1845121 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10983192
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): NKAIN2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045860, RRID:AB_10983192 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853582
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): MARK3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA024652, RRID:AB_1853582 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.