Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 67 showing 1321 ~ 1340 out of 55,391 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10962867

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): AGXT2L1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA044546, RRID:AB_10962867 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854827

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): POSTN antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA012306, RRID:AB_1854827 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10966564

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): KDELC2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA039817, RRID:AB_10966564 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10603140

Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): UBOX5 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA028871, RRID:AB_10603140 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964166

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): VAT1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA045170, RRID:AB_10964166 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10966216

Comments:
Host Organism:
Clonality polyclonal
Target(s): SPG7 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA044447, RRID:AB_10966216 Copy   

    • RRID:AB_11164652

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_11164652

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40835 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): MLLT3

Proper citation: GeneTex Cat# GTX102835, RRID:AB_11164652 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2335695

Comments: Used By NYUIHC-114. Original Manufacturer: Dako. Now part of Agilent.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): EBV transformed B-lymphoblastoid cells

Proper citation: Agilent Cat# V1617, RRID:AB_2335695 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854786

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OR2K2

Proper citation: Atlas Antibodies Cat# HPA024261, RRID:AB_1854786 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680977

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PFKFB2

Proper citation: Atlas Antibodies Cat# HPA049975, RRID:AB_2680977 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680876

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SSUH2

Proper citation: Atlas Antibodies Cat# HPA049777, RRID:AB_2680876 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10669522

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QLATHFPSEDILLVTASPVIKAVTNFKQISKILEEFDVEEQSSTMLGKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKLICEGN; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): PYROXD1

Proper citation: Atlas Antibodies Cat# HPA038319, RRID:AB_10669522 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796903

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HECA

Proper citation: Atlas Antibodies Cat# HPA042313, RRID:AB_10796903 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796681

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ARAP3

Proper citation: Atlas Antibodies Cat# HPA042887, RRID:AB_10796681 Copy   

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10631036

Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): PUF60

Proper citation: Bethyl Cat# A302-817A, RRID:AB_10631036 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10670930

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NOLC1

Proper citation: Atlas Antibodies Cat# HPA037366, RRID:AB_10670930 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1849641

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GGCX

Proper citation: Atlas Antibodies Cat# HPA018284, RRID:AB_1849641 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684133

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): WDR72

Proper citation: Atlas Antibodies Cat# HPA059819, RRID:AB_2684133 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601002

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C6orf118

Proper citation: Atlas Antibodies Cat# HPA029789, RRID:AB_10601002 Copy   

    • RRID:AB_2616323

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2616323

Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: guinea pig
Clonality unknown
Target(s): lin-54

Proper citation: Robert Horvitz Cat# non-commercial lin-54 modENCODE antibody 1, RRID:AB_2616323 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch