Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2144182
Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): METRNL
Proper citation: Sigma-Aldrich Cat# HPA023792, RRID:AB_2144182 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079581
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human PCQAP
Proper citation: Sigma-Aldrich Cat# HPA003179, RRID:AB_1079581 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1211310
Comments: Applications: WB, IP, ChIP-Seq
Host Organism: rabbit
Clonality polyclonal
Target(s): PCAF
Proper citation: Bethyl Cat# A301-666A, RRID:AB_1211310 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602296
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RNF213
Proper citation: Atlas Antibodies Cat# HPA026790, RRID:AB_10602296 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673349
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): C6orf58
Proper citation: Atlas Antibodies Cat# HPA036263, RRID:AB_10673349 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2106116
Comments: Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot E1211 for G1E-ER4,G1E,mES; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): FLI1
Proper citation: Santa Cruz Biotechnology Cat# sc-356, RRID:AB_2106116 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684823
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): COX16
Proper citation: Atlas Antibodies Cat# HPA062659, RRID:AB_2684823 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732661
Comments: Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CALCR
Proper citation: Atlas Antibodies Cat# HPA061428, RRID:AB_2732661 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078462
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human PECAM1
Proper citation: Sigma-Aldrich Cat# HPA004690, RRID:AB_1078462 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857760
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human TLN1
Proper citation: Sigma-Aldrich Cat# HPA004748, RRID:AB_1857760 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2073233
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Western Blot; Immunofluorescence; WB, IP, IF, IHC(P), ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): CD4 (H-370)
Proper citation: Santa Cruz Biotechnology Cat# sc-7219, RRID:AB_2073233 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674884
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): CSN3
Proper citation: Sigma-Aldrich Cat# HPA035954, RRID:AB_2674884 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672500
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSSIGSVLDDADREVSSLTDRAFRSLCISEDTSFHDSYLAVSPDITRQVFGTFHQRTVGHTQRKSGIWSQLPSQGTEHSGWAATFQQLPKYVQGEE; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): C10orf71
Proper citation: Atlas Antibodies Cat# HPA037962, RRID:AB_10672500 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675504
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FBXW12
Proper citation: Atlas Antibodies Cat# HPA037491, RRID:AB_2675504 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683744
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ERF
Proper citation: Atlas Antibodies Cat# HPA058532, RRID:AB_2683744 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857623
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): STX7
Proper citation: Atlas Antibodies Cat# HPA001467, RRID:AB_1857623 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683117
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CADPS2
Proper citation: Atlas Antibodies Cat# HPA056398, RRID:AB_2683117 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794028
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CEP57L1
Proper citation: Atlas Antibodies Cat# HPA040378, RRID:AB_10794028 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683149
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TECR
Proper citation: Atlas Antibodies Cat# HPA056488, RRID:AB_2683149 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686672
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): METTL22
Proper citation: Atlas Antibodies Cat# HPA074173, RRID:AB_2686672 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
