Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678091
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BTBD19
Proper citation: Atlas Antibodies Cat# HPA042633, RRID:AB_2678091 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601490
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): POGK
Proper citation: Atlas Antibodies Cat# HPA031630, RRID:AB_10601490 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794181
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ECE2
Proper citation: Atlas Antibodies Cat# HPA043346, RRID:AB_10794181 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684610
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C1orf52
Proper citation: Atlas Antibodies Cat# HPA061790, RRID:AB_2684610 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603893
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): STAT5A
Proper citation: Atlas Antibodies Cat# HPA027873, RRID:AB_10603893 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2670788
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA0368
Proper citation: Atlas Antibodies Cat# HPA021646, RRID:AB_2670788 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676238
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FBXW8
Proper citation: Atlas Antibodies Cat# HPA038850, RRID:AB_2676238 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686278
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TOR1AIP2
Proper citation: Atlas Antibodies Cat# HPA070542, RRID:AB_2686278 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678975
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TNLNPSTCPSRPSVQSSHFPSGSYSVRDVFQVQKAKKSTEEEHKEVFRAAVDLEISSASRTCTFLPPFPAHLPTSPDTNKAESSGKWNGLHTPVSVQSRLNLSIEVPSPSQLDQSVLEALPPDLREQVEQVCAVQ; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): REV1
Proper citation: Atlas Antibodies Cat# HPA044534, RRID:AB_2678975 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602311
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): QRSL1
Proper citation: Atlas Antibodies Cat# HPA029587, RRID:AB_10602311 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732374
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): HS6ST3
Proper citation: Atlas Antibodies Cat# HPA078257, RRID:AB_2732374 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673382
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PSMB10
Proper citation: Atlas Antibodies Cat# HPA030224, RRID:AB_2673382 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079213
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KLHDC7B
Proper citation: Atlas Antibodies Cat# HPA000518, RRID:AB_1079213 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11142683
Comments: Applications: FC
Host Organism: mouse
Clonality monoclonal
Target(s): CD56
Proper citation: BioLegend Cat# 318333, RRID:AB_11142683 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10000581
Comments: Applications: Western Blot, Simple Western, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunoprecipitation (Negative), Dual RNAscope ISH-IHC
Host Organism: Rabbit
Clonality polyclonal
Target(s): xCT
Proper citation: Novus Cat# NB300-318, RRID:AB_10000581 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600795
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): C1orf87 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031368, RRID:AB_10600795 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601366
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): EPB41 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028414, RRID:AB_10601366 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599417
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): ZBTB8B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027818, RRID:AB_10599417 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672082
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): RPP14 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA036194, RRID:AB_10672082 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603780
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): C9orf150 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA024407, RRID:AB_10603780 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.