Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682667
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM149A
Proper citation: Atlas Antibodies Cat# HPA055004, RRID:AB_2682667 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683429
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RP11-111M22.2
Proper citation: Atlas Antibodies Cat# HPA057405, RRID:AB_2683429 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679339
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MPND
Proper citation: Atlas Antibodies Cat# HPA045475, RRID:AB_2679339 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672381
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRERF1
Proper citation: Atlas Antibodies Cat# HPA027771, RRID:AB_2672381 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600309
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SRGAP2
Proper citation: Atlas Antibodies Cat# HPA028191, RRID:AB_10600309 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079641
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATP2B3
Proper citation: Atlas Antibodies Cat# HPA001583, RRID:AB_1079641 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601606
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): STAM2
Proper citation: Atlas Antibodies Cat# HPA035528, RRID:AB_10601606 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615984
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 071912.PRL/RAP for not specified; status is not pursued
Host Organism: mouse
Clonality unknown
Target(s): ZBTB2
Proper citation: CDI Cat# R6.1.3.46F2, RRID:AB_2615984 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_631263
Comments: Discontinued: 2016; Discontinued: 2016; Rabbit polyclonal to amino acids 1-79 mapping at the N-terminus of c-Jun p39 of human origin. Antibody Target: JUN
Validation: ENCODE PROJECT validation information available
Host Organism: rabbit
Clonality polyclonal
Target(s): JUN
Proper citation: Santa Cruz Biotechnology Cat# sc-1694, RRID:AB_631263 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2620257
Comments: Applications: IP
Host Organism: goat
Clonality polyclonal
Target(s): HIF1-alpha
Proper citation: Bethyl Cat# A303-907A, RRID:AB_2620257 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616029
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 10 for not specified; status is awaiting lab characterization. ENCODE PROJECT External validation DATA SET is released testing lot 1 for not specified; status is not eligible for new data. ENCODE PROJECT External validation DATA SET is released testing lot 1 for any cell type or tissues; status is awaiting lab characterization. Consolidated with AB_1147656, and AB_1147655 on 09/21/16
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): H3K27me3
Proper citation: Cell Signaling Technology Cat# 9733, RRID:AB_2616029 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795390
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SIX5
Proper citation: Atlas Antibodies Cat# HPA042068, RRID:AB_10795390 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680843
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC18B1
Proper citation: Atlas Antibodies Cat# HPA049659, RRID:AB_2680843 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681945
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ASVQQGEKQLFEKFWRGTFKAVATPRPESIIVASITARKPLPRTEPQNNPVVPAQDGPSEKLGQHLATEPLGTNSWERDKTCRELG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): SRRM4
Proper citation: Atlas Antibodies Cat# HPA052783, RRID:AB_2681945 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683805
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC62
Proper citation: Atlas Antibodies Cat# HPA058741, RRID:AB_2683805 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601130
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIF1BP
Proper citation: Atlas Antibodies Cat# HPA035538, RRID:AB_10601130 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2668800
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NCBP3
Proper citation: Atlas Antibodies Cat# HPA013195, RRID:AB_2668800 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673227
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RGL4
Proper citation: Atlas Antibodies Cat# HPA035979, RRID:AB_10673227 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670923
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ANKS1A
Proper citation: Atlas Antibodies Cat# HPA036768, RRID:AB_10670923 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681515
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PLD4
Proper citation: Atlas Antibodies Cat# HPA051512, RRID:AB_2681515 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.