Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616009
Comments: Applications: W, IP, IHC-P
Host Organism: rabbit
Clonality monoclonal
Target(s): hnRNP D0
Proper citation: Cell Signaling Technology Cat# 12382, RRID:AB_2616009 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858913
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Western Blot; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): STK32B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015820, RRID:AB_1858913 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10901885
Comments: validation status unknown, seller recommendations provided in 2012: Immunohistochemistry - fixed; Western Blot; ELISA; Immunohistochemistry; Immunoprecipitation; Immunocytochemistry; Immunohistochemistry - frozen; ELISA, ICC, IHC-Fr, IHC-P, IP, WB
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): MAP2 antibody [MT-08]
Proper citation: Abcam Cat# ab118898, RRID:AB_10901885 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847464
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human DAAM1
Proper citation: Sigma-Aldrich Cat# HPA026605, RRID:AB_1847464 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851802
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human INPP5A
Proper citation: Sigma-Aldrich Cat# HPA012285, RRID:AB_1851802 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2221026
Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ZSCAN22 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA006471, RRID:AB_2221026 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_831726
Comments: validation status unknown check with seller; recommendations: WB, IP, IF, ELISA; Western Blot; Immunoprecipitation; Immunofluorescence; ELISA
Host Organism: mouse
Clonality monoclonal
Target(s): Somatostatin (G-10)
Proper citation: Santa Cruz Biotechnology Cat# sc-55565, RRID:AB_831726 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846605
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CGREF1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA008241, RRID:AB_1846605 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079280
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human LRRC62
Proper citation: Sigma-Aldrich Cat# HPA000781, RRID:AB_1079280 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854340
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human NDRG3
Proper citation: Sigma-Aldrich Cat# HPA017851, RRID:AB_1854340 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854891
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunofluorescence; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): P4HA1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA007599, RRID:AB_1854891 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852408
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA1462
Proper citation: Atlas Antibodies Cat# HPA017956, RRID:AB_1852408 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2095295
Comments: Discontinued: 2016; Applications: WB, IF, ELISA; Immunodiffusion; Immunofluorescence; ELISA; Other; Western Blot
Info: Used by Czech Centre for Phenogenomics
Host Organism: rat
Clonality polyclonal
Target(s): DSC1 (L-15)
Proper citation: Santa Cruz Biotechnology Cat# sc-18115, RRID:AB_2095295 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685428
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OSTC
Proper citation: Atlas Antibodies Cat# HPA065174, RRID:AB_2685428 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679405
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SPATA33
Proper citation: Atlas Antibodies Cat# HPA045648, RRID:AB_2679405 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603982
Comments: ENCODE PROJECT External validation DATA SET is released testing lot A82758 for HepG2,GM12878,MCF-7,liver,K562; status is awaiting lab characterization,not eligible for new data
Host Organism: rabbit
Clonality polyclonal
Target(s): PAX8
Proper citation: Sigma-Aldrich Cat# HPA030062, RRID:AB_10603982 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959523
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DEFB108B
Proper citation: Atlas Antibodies Cat# HPA042588, RRID:AB_10959523 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673101
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): HEMK1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA034702, RRID:AB_10673101 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669537
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFQSQTAIKHANSVDTSFSKDVLNSIAAFSSIAISTVNHADSRASLASLDSNPSTNEK; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): DOCK10
Proper citation: Atlas Antibodies Cat# HPA035749, RRID:AB_10669537 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11205284
Comments: Discontinued; Applications: IP (2-10 µg/mg lysate)
Host Organism: rabbit
Clonality polyclonal
Target(s): ETV3
Proper citation: Thermo Fisher Scientific Cat# A303-736A, RRID:AB_11205284 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.