Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 90 showing 1781 ~ 1800 out of 55,391 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection
  • RRID:AB_2682171

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682171

Comments:
Host Organism: rabbit
Clonality unknown
Target(s): PCK2

Proper citation: Sigma-Aldrich Cat# HPA053502, RRID:AB_2682171 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1857798

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): TBCE antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA026557, RRID:AB_1857798 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796327

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): NARG2 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA039416, RRID:AB_10796327 Copy   


  • RRID:AB_2683815

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683815

Comments:
Host Organism: rabbit
Clonality unknown
Target(s): NID2

Proper citation: Sigma-Aldrich Cat# HPA058772, RRID:AB_2683815 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078465

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): CD4

Proper citation: Atlas Antibodies Cat# HPA004472, RRID:AB_1078465 Copy   


  • RRID:AB_2686497

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686497

Comments:
Host Organism: rabbit
Clonality unknown
Target(s): PAK4

Proper citation: Sigma-Aldrich Cat# HPA072220, RRID:AB_2686497 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10611679

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): ASB5 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA028870, RRID:AB_10611679 Copy   


  • RRID:AB_2732280

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2732280

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PTOV1

Proper citation: Atlas Antibodies Cat# HPA075125, RRID:AB_2732280 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_842530

Comments: manufacturer recommendations: IgG WB, IHC; ELISA; Western Blot; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615136, AB_842530.
Host Organism: rabbit
Clonality polyclonal
Target(s): SFRS10 (splicing factor arginine/serine-rich 10 (transformer 2 homolog Drosophila)) (against the middle region of SFRS10) (100ug)

Proper citation: Aviva Systems Biology Cat# ARP40529_T100, RRID:AB_842530 Copy   


  • RRID:AB_1140040

    This resource has 100+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1140040

Comments: Applications: Immunoprecipitation; Immunofluorescence; Immunohistochemistry; Flow Cytometry; Western Blot; Immunocytochemistry; Immunohistochemistry - fixed; Flow Cyt, ICC/IF, IHC-FoFr, IHC-Fr, IHC-P, IHC-R, IP, RIA, WB; Immunohistochemistry - frozen; Radioimmunoassay
Info: Used by Czech Centre for Phenogenomics
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rat
Clonality monoclonal
Target(s): F4/80 antibody [CI:A3-1]

Proper citation: Abcam Cat# ab6640, RRID:AB_1140040 Copy   


  • RRID:AB_2680333

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680333

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PDCL2

Proper citation: Atlas Antibodies Cat# HPA048260, RRID:AB_2680333 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682108

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MGST3

Proper citation: Atlas Antibodies Cat# HPA053311, RRID:AB_2682108 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680932

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TFTYLTTSFPGSMNHGRFASVF; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): OR8B4

Proper citation: Atlas Antibodies Cat# HPA049884, RRID:AB_2680932 Copy   


  • RRID:AB_10600093

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10600093

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SEPT7

Proper citation: Atlas Antibodies Cat# HPA023309, RRID:AB_10600093 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678721

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM170B

Proper citation: Atlas Antibodies Cat# HPA043899, RRID:AB_2678721 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679280

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SMN1

Proper citation: Atlas Antibodies Cat# HPA045271, RRID:AB_2679280 Copy   


  • RRID:AB_2685241

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685241

Comments:
Host Organism: rabbit
Clonality unknown
Target(s): BLMH

Proper citation: Sigma-Aldrich Cat# HPA064307, RRID:AB_2685241 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681466

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): MPZL2

Proper citation: Atlas Antibodies Cat# HPA051395, RRID:AB_2681466 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2677185

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LARS

Proper citation: Atlas Antibodies Cat# HPA040881, RRID:AB_2677185 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678828

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCNH

Proper citation: Atlas Antibodies Cat# HPA044138, RRID:AB_2678828 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X