Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
AUF1/hnRNP D (D6O4F) Rabbit mAb Resource Report Resource Website 1+ mentions Rating or validation data |
Cell Signaling Technology Cat# 12382, RRID:AB_2616009 | hnRNP D0 | h | Clone D6O4F | Applications: W, IP, IHC-P | monoclonal | rabbit | AB_2616009 | Cell Signaling Technology | 12382 | 2025-08-19 10:16:32 | 4 | |
|
Anti-STK32B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA015820, RRID:AB_1858913 | STK32B antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Western Blot; Other | polyclonal | rabbit | AB_1858913 | Sigma-Aldrich | HPA015820 | 2025-08-19 10:16:30 | 0 | ||
|
MAP2 antibody [MT-08] Resource Report Resource Website Rating or validation data |
Abcam Cat# ab118898, RRID:AB_10901885 | MAP2 antibody [MT-08] | cow, bovine, human |
validation status unknown, seller recommendations provided in 2012: Immunohistochemistry - fixed; Western Blot; ELISA; Immunohistochemistry; Immunoprecipitation; Immunocytochemistry; Immunohistochemistry - frozen; ELISA, ICC, IHC-Fr, IHC-P, IP, WB Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_10901885 | Abcam | ab118898 | 2025-08-19 10:16:33 | 0 | ||
|
Anti-DAAM1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA026605, RRID:AB_1847464 | Human DAAM1 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847464 | Sigma-Aldrich | HPA026605 | 2025-08-19 10:16:38 | 0 | ||
|
Anti-INPP5A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA012285, RRID:AB_1851802 | Human INPP5A | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1851802 | Sigma-Aldrich | HPA012285 | 2025-08-19 10:16:17 | 0 | ||
|
Anti-ZSCAN22 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA006471, RRID:AB_2221026 | ZSCAN22 antibody produced in rabbit | human | Vendor recommendations: Immunofluorescence; Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_2221026 | Sigma-Aldrich | HPA006471 | 2025-08-19 10:16:28 | 0 | ||
|
Somatostatin (G-10) Resource Report Resource Website 10+ mentions Rating or validation data |
Santa Cruz Biotechnology Cat# sc-55565, RRID:AB_831726 | Somatostatin (G-10) | rat, mouse, human | validation status unknown check with seller; recommendations: WB, IP, IF, ELISA; Western Blot; Immunoprecipitation; Immunofluorescence; ELISA | monoclonal | mouse | AB_831726 | Santa Cruz Biotechnology | sc-55565 | 2025-08-19 10:16:51 | 20 | ||
|
Anti-CGREF1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA008241, RRID:AB_1846605 | CGREF1 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1846605 | Sigma-Aldrich | HPA008241 | 2025-08-19 10:16:48 | 0 | ||
|
ANTI-ELFN2 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA000781, RRID:AB_1079280 | Human LRRC62 | human | Vendor recommendations: | unknown | rabbit | AB_1079280 | Sigma-Aldrich | HPA000781 | 2025-08-19 10:16:45 | 3 | ||
|
Anti-NDRG3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA017851, RRID:AB_1854340 | Human NDRG3 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1854340 | Sigma-Aldrich | HPA017851 | 2025-08-19 10:19:26 | 0 | ||
|
Anti-P4HA1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA007599, RRID:AB_1854891 | P4HA1 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunofluorescence; Western Blot; Immunohistochemistry | polyclonal | rabbit | AB_1854891 | Sigma-Aldrich | HPA007599 | 2025-08-19 10:19:39 | 0 | ||
|
Anti-KIAA1462 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA017956, RRID:AB_1852408 | KIAA1462 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1852408 | Atlas Antibodies | HPA017956 | 2025-08-19 10:19:54 | 0 | ||
|
DSC1 (L-15) Resource Report Resource Website Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-18115, RRID:AB_2095295 | DSC1 (L-15) | rat, goat, mouse, human |
Discontinued: 2016; Applications: WB, IF, ELISA; Immunodiffusion; Immunofluorescence; ELISA; Other; Western Blot Info: Used by Czech Centre for Phenogenomics |
polyclonal | rat | AB_2095295 | Santa Cruz Biotechnology | sc-18115 | 2025-08-19 10:19:55 | 0 | ||
|
Anti-OSTC polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA065174, RRID:AB_2685428 | OSTC | human | Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2685428 | Atlas Antibodies | HPA065174 | 2025-08-19 10:19:59 | 0 | ||
|
Anti-SPATA33 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA045648, RRID:AB_2679405 | SPATA33 | human | Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2679405 | Atlas Antibodies | HPA045648 | 2025-08-19 10:19:59 | 0 | ||
|
PAX8-human Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA030062, RRID:AB_10603982 | PAX8 | homo sapiens | ENCODE PROJECT External validation DATA SET is released testing lot A82758 for HepG2,GM12878,MCF-7,liver,K562; status is awaiting lab characterization,not eligible for new data | polyclonal | rabbit | AB_10603982 | Sigma-Aldrich | HPA030062 | 2025-08-19 10:19:56 | 0 | ||
|
Anti-DEFB108B polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA042588, RRID:AB_10959523 | DEFB108B | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10959523 | Atlas Antibodies | HPA042588 | 2025-08-19 10:19:57 | 0 | ||
|
Anti-HEMK1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA034702, RRID:AB_10673101 | HEMK1 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_10673101 | Sigma-Aldrich | HPA034702 | 2025-08-19 10:19:58 | 0 | ||
|
Anti-DOCK10 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA035749, RRID:AB_10669537 | DOCK10 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFQSQTAIKHANSVDTSFSKDVLNSIAAFSSIAISTVNHADSRASLASLDSNPSTNEK; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10669537 | Atlas Antibodies | HPA035749 | 2025-08-19 10:19:56 | 0 | ||
|
ETV3 Antibody Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Thermo Fisher Scientific Cat# A303-736A, RRID:AB_11205284 | ETV3 | human | Discontinued; Applications: IP (2-10 µg/mg lysate) | polyclonal | rabbit | AB_11205284 | Thermo Fisher Scientific | A303-736A (also A303-736A-T) | 2025-08-19 10:20:05 | 1 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.