Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-TPCN2 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA027080, RRID:AB_10600917 TPCN2 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10600917 Atlas Antibodies HPA027080 2025-08-19 10:19:00 1
Anti-CFDP1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048242, RRID:AB_2680327 CFDP1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKE; Manufacturer approved use: ICC-IF, WB polyclonal rabbit AB_2680327 Atlas Antibodies HPA048242 2025-08-19 10:19:01 0
Anti-TTLL7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059321, RRID:AB_2683978 TTLL7 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683978 Atlas Antibodies HPA059321 2025-08-19 10:19:01 0
Anti-MPEG1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA046801, RRID:AB_2679814 MPEG1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679814 Atlas Antibodies HPA046801 2025-08-19 10:19:18 0
Anti-HIST2H2BE polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043013, RRID:AB_2678269 HIST2H2BE rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678269 Atlas Antibodies HPA043013 2025-08-19 10:19:01 0
Anti-ENTPD5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA002927, RRID:AB_1078744 ENTPD5 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078744 Atlas Antibodies HPA002927 2025-08-19 10:19:00 0
Anti-GRID2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056253, RRID:AB_2683079 GRID2 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683079 Atlas Antibodies HPA056253 2025-08-19 10:19:01 0
Anti-CALR3
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043355, RRID:AB_2678442 CALR3 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2678442 Atlas Antibodies HPA043355 2025-08-19 10:19:18 0
Anti-CLOCK polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001867, RRID:AB_1078537 CLOCK human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078537 Atlas Antibodies HPA001867 2025-08-19 10:19:00 0
Anti-CLEC4M polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042661, RRID:AB_2678101 CLEC4M human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678101 Atlas Antibodies HPA042661 2025-08-19 10:19:01 0
Anti-PHKG2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA068751, RRID:AB_2686025 PHKG2 human Originating manufacturer of this product. Applications: ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2686025 Atlas Antibodies HPA068751 2025-08-19 10:19:19 0
Anti-FKBP6
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA061109, RRID:AB_2684430 FKBP6 human unknown rabbit AB_2684430 Sigma-Aldrich HPA061109 2025-08-19 10:19:03 0
Anti-PEF1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA061608, RRID:AB_2684567 PEF1 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684567 Atlas Antibodies HPA061608 2025-08-19 10:19:01 0
NPY (Neuropeptide Y)
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
J.B. Furness, Flinders University, Australia Cat# E2210, RRID:AB_2783534 NPY (Neuropeptide Y) rat, rabbit, human PMID:3839715 polyclonal sheep AB_2783534 J.B. Furness, Flinders University, Australia E2210 2025-08-19 10:19:21 2
Anti-FBXW2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA067878, RRID:AB_2685913 FBXW2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685913 Atlas Antibodies HPA067878 2025-08-19 10:19:01 0
Anti-PRR19 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA070350, RRID:AB_2686259 PRR19 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686259 Atlas Antibodies HPA070350 2025-08-19 10:19:19 0
Anti-COG2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA076994, RRID:AB_2686823 COG2 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686823 Atlas Antibodies HPA076994 2025-08-19 10:19:02 0
Anti-CREB3L1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA024069, RRID:AB_1854750 CREB3L1 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1854750 Sigma-Aldrich HPA024069 2025-08-19 10:23:46 1
Anti-GPR78
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA013209, RRID:AB_10601657 GPR78 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10601657 Atlas Antibodies HPA013209 2025-08-19 10:24:12 0
Anti-RBL1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056525, RRID:AB_2683165 RBL1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2683165 Atlas Antibodies HPA056525 2025-08-19 10:24:13 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.