Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 96 showing 1901 ~ 1920 out of 55,391 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2250114

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MAGEB17

Proper citation: Atlas Antibodies Cat# HPA003756, RRID:AB_2250114 Copy   

    • RRID:AB_10950403

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10950403

Comments: Discontinued; Applications: IP (2-10 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF316

Proper citation: Thermo Fisher Scientific Cat# A303-248A, RRID:AB_10950403 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845839

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SPATA31E1

Proper citation: Atlas Antibodies Cat# HPA024253, RRID:AB_1845839 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2190597

Comments: Applications: Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Flow (Intracellular)
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: Rabbit
Clonality polyclonal
Target(s): EAAT1/GLAST-1/SLC1A3

Proper citation: Novus Cat# NB100-1869, RRID:AB_2190597 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1522605

Comments: Applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality polyclonal
Target(s): TrkC

Proper citation: Novus Cat# NBP1-03448, RRID:AB_1522605 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854847

Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): OTUD7B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA027045, RRID:AB_1854847 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680800

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OR4C5

Proper citation: Atlas Antibodies Cat# HPA049516, RRID:AB_2680800 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686005

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): IFRD2

Proper citation: Atlas Antibodies Cat# HPA068560, RRID:AB_2686005 Copy   

    • RRID:AB_10602715

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602715

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): NSUN3

Proper citation: Atlas Antibodies Cat# HPA036181, RRID:AB_10602715 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685305

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NETO1

Proper citation: Atlas Antibodies Cat# HPA064630, RRID:AB_2685305 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1853590

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): MAS1

Proper citation: Atlas Antibodies Cat# HPA013564, RRID:AB_1853590 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079714

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PTPRN

Proper citation: Atlas Antibodies Cat# HPA007179, RRID:AB_1079714 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794885

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): GSG1 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA043371, RRID:AB_10794885 Copy   

    • RRID:AB_2678720

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678720

Comments:
Host Organism: rabbit
Clonality unknown
Target(s): MYBPC3

Proper citation: Sigma-Aldrich Cat# HPA043898, RRID:AB_2678720 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795042

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): DEFB134 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA044494, RRID:AB_10795042 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078329

Comments: Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): C14orf43 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA003111, RRID:AB_1078329 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601467

Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ERO1L antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA030053, RRID:AB_10601467 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079627

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Immunofluorescence; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): PRKCD antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA001863, RRID:AB_1079627 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10670286

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): GPR152 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA035078, RRID:AB_10670286 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795540

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): C14orf159 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA041423, RRID:AB_10795540 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch