Searching across hundreds of databases
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2885047
Comments: Applications: WB, Flow, ICC/IF, IHC, IHC-P
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4724169
Host Organism: mouse
Clonality monoclonal
Target(s): Moesin
Proper citation: (Novus Cat# NBP2-44579, RRID:AB_2885047) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2892752
Comments: Applications: WB, Flow, IHC, IHC-P, IHC with 1% PFA fixed frozen samples.
Host Organism: rabbit
Clonality recombinant monoclonal
Target(s): Podocin/NPHS2
Proper citation: (Novus Cat# NBP2-75624, RRID:AB_2892752) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2892751
Comments: Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC with 1% PFA fixed frozen samples.
Host Organism: rat
Clonality monoclonal
Target(s): Langerin/CD207
Proper citation: (Novus Cat# DDX0362P, RRID:AB_2892751) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10000524
Comments: Rabbit polyclonal, maps to a region between residues 350 and the C-terminus (residue 412). Antibody Target: BHLHE40
Validation: ENCODE PROJECT validation information available
Host Organism: rabbit
Clonality polyclonal
Target(s): BHLHE40
Proper citation: (Novus Cat# NB100-1800, RRID:AB_10000524) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10000524
Comments: ENCODE PROJECT External validation DATA SET is released testing lot A1 for IMR90,K562,HeLa-S3,GM12878,HepG2; status is eligible for new data
Host Organism: rabbit
Clonality polyclonal
Target(s): BHLHE40
Proper citation: (Novus Cat# NB100-1800, RRID:AB_10000524) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10001343
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 1 for not specified; status is not eligible for new data
Host Organism: rabbit
Clonality polyclonal
Target(s): TBL1XR1
Proper citation: (Novus Cat# NB600-270, RRID:AB_10001343) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_350341
Comments: Used By NYUIHC-1262
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): The immunogen recognized by this antibody maps to a region between residues 775 and the C-terminus (residue 826) of human hypoxia-inducible factor 1 (Q16665).
Proper citation: (Novus Cat# NB 100-449, RRID:AB_350341) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_350059
Comments: Used By NYUIHC-845
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein
Proper citation: (Novus Cat# NB 100-122, RRID:AB_350059) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_350071
Comments: Applications: WB, Simple Western, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, CHIP-SEQ, Dual ISH-IHC, KO
ENCODE PROJECT External validation DATA SET is released testing lot P-1 for not specified; status is not pursued
Consolidated with AB_10131941, and AB_350071 on 10/10/16
Host Organism: rabbit
Clonality polyclonal
Target(s): HIF-1 alpha
Proper citation: (Novus Cat# NB100-134, RRID:AB_350071) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335858
Comments: Used By NYUIHC-1453
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): A synthetic peptide made to an internal portion of the human GLUT2 protein (between residues 50-150), Integral membrane. Human and mouse. Immunogen sequence has 84% homology to bovine and 78% homology to rat.
Proper citation: (Novus Cat# NBP2-22218, RRID:AB_2335858) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_669581
Comments: Used By NYUIHC-1067
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): A synthetic peptide made to the N-terminal region of the human LC3, isoform B protein.
Proper citation: (Novus Cat# NB600-1384, RRID:AB_669581) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_838249
Comments: validation status unknown, reseller suggested use: Western Blot; flow cytometry / FACS analysis, Immunocytochemistry, Western Blot
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): Murine FOXP3
Proper citation: (Novus Cat# NB100-39002, RRID:AB_838249) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2172600
Comments: validation status unknown, reseller suggested use: IgG; IgG Western Blot; Western Blot
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): PSAT1
Proper citation: (Novus Cat# NBP1-32920, RRID:AB_2172600) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10010339
Comments: Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, Immunohistochemistry - frozen, Immunohistochemistry-Frozen, Immunohistochemistry-Paraffin, Western Blot
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4730966
Host Organism: mouse
Clonality monoclonal
Target(s): CD44
Proper citation: (Novus Cat# NBP1-47386, RRID:AB_10010339) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2133841
Comments: validation status unknown, reseller suggested use: IgG; IgG Immunofluorescence, Western Blot; Immunofluorescence; Western Blot
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): KPNA4
Proper citation: (Novus Cat# NBP1-31260, RRID:AB_2133841) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11027910
Comments: Used By NYUIHC-1452
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): Recombinant Protein corresponding to amino acids:FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYR PRPDSYHLL (Expected to cross react based on sequence identity: Mouse (89%) Rat (91%))
Proper citation: (Novus Cat# NBP1-92384, RRID:AB_11027910) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11023675
Comments: validation status unknown, reseller suggested use: IgG; IgG Immunohistochemistry; Immunohistochemistry - fixed; Western Blot; Immunofluorescence; Immunofluorescence, Immunohistochemistry-Paraffin, Western Blot
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): EMI1
Proper citation: (Novus Cat# NBP1-84850, RRID:AB_11023675) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10001196
Comments: validation status unknown, reseller suggested use: Immunofluorescence, Immunohistochemistry-Frozen, Immunohistochemistry-Paraffin, Western Blot; Immunohistochemistry; Immunohistochemistry - fixed; Immunofluorescence; Immunohistochemistry - frozen; Western Blot
Host Organism: rabbit
Clonality unknown
Target(s): GAP43
Proper citation: (Novus Cat# NB300-143, RRID:AB_10001196) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2190597
Comments: validation status unknown, reseller suggested use: IgG; IgG Western Blot; Western Blot
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): SLC1A3
Proper citation: (Novus Cat# NB100-1869, RRID:AB_2190597) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10002142
Comments: validation status unknown, reseller suggested use: IgG; IgG ChIP; Immunohistochemistry; Immunohistochemistry - fixed; Super Shift Assay; Western Blot; Chromatin Immunoprecipitation, Gel Super Shift Assays, Immunohistochemistry-Paraffin, Western Blot
Host Organism: rabbit
Clonality unknown
Target(s): MafA
Proper citation: (Novus Cat# NB400-137, RRID:AB_10002142) Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
