Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_2797674
Comments: Applications: F
Host Organism: rabbit
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Cell Signaling Technology Cat# 8864, RRID:AB_2797674) Copy
http://antibodyregistry.org/AB_2887275
Comments: Applications: WB
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (GeneTex Cat# GTX134417, RRID:AB_2887275) Copy
http://antibodyregistry.org/AB_2876809
Comments: Applications: Indirect Flow Cytometry, Immunohistochemistry, Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (Alomone Labs Cat# ANT-045, RRID:AB_2876809) Copy
http://antibodyregistry.org/AB_2938783
Comments: Applications: ELISA
Host Organism: mouse
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Sino Biological Cat# 10164-MM04, RRID:AB_2938783) Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679368
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEA; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (Atlas Antibodies Cat# HPA045563, RRID:AB_2679368) Copy
Discontinued
http://antibodyregistry.org/AB_1075411
Comments: Discontinued: 2019; Applications: IP (1-10 µg/mL)
Host Organism: mouse
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Thermo Fisher Scientific Cat# MA1-10853, RRID:AB_1075411) Copy
http://antibodyregistry.org/AB_1676674
Comments: manufacturer recommendations: Western Blot; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (Abnova Cat# PAB11773, RRID:AB_1676674) Copy
http://antibodyregistry.org/AB_1676602
Comments: manufacturer recommendations: Immunohistochemistry; Western Blot; Immunohistochemistry-P, Western Blot (Cell Lysate)
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (Abnova Cat# PAB7683, RRID:AB_1676602) Copy
Discontinued
http://antibodyregistry.org/AB_11404516
Comments: Discontinued: 2015; Discontinued on 27 July 2015; ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DPABT-H21602, RRID:AB_11404516) Copy
Discontinued
http://antibodyregistry.org/AB_11404506
Comments: Discontinued: 2015; Discontinued on 27 July 2015; WB,IHC,IFA
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DPABT-H21411H, RRID:AB_11404506) Copy
Discontinued
http://antibodyregistry.org/AB_11404489
Comments: Discontinued: 2015; Discontinued on 27 July 2015; (null)
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DPABT-H10675, RRID:AB_11404489) Copy
Discontinued
http://antibodyregistry.org/AB_11404498
Comments: Discontinued: 2015; Discontinued on 27 July 2015; Flow Cyt
Host Organism: mouse
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DMABT-H22485, RRID:AB_11404498) Copy
Discontinued
http://antibodyregistry.org/AB_11404499
Comments: Discontinued: 2015; Discontinued on 27 July 2015; Flow Cyt
Host Organism: mouse
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DMABT-H22486, RRID:AB_11404499) Copy
Discontinued
http://antibodyregistry.org/AB_11404507
Comments: Discontinued: 2015; Discontinued on 27 July 2015; ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DPABT-H21602H, RRID:AB_11404507) Copy
Discontinued
http://antibodyregistry.org/AB_11404494
Comments: Discontinued: 2015; Discontinued on 27 July 2015; (null)
Host Organism: rabbit
Clonality polyclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DPABT-H5862, RRID:AB_11404494) Copy
Discontinued
http://antibodyregistry.org/AB_11404502
Comments: Discontinued: 2015; Discontinued on 27 July 2015; ELISA,IHC,Neut,WB
Host Organism: mouse
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DMABT-H16806, RRID:AB_11404502) Copy
Discontinued
http://antibodyregistry.org/AB_11404505
Comments: Discontinued: 2015; Discontinued on 27 July 2015; Flow Cyt
Host Organism: mouse
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DMABT-H29674, RRID:AB_11404505) Copy
Discontinued
http://antibodyregistry.org/AB_11404508
Comments: Discontinued: 2015; Discontinued on 27 July 2015; WB
Host Organism: rabbit
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DMABT-H19955, RRID:AB_11404508) Copy
Discontinued
http://antibodyregistry.org/AB_11404487
Comments: Discontinued: 2015; Discontinued on 27 July 2015; IHC-P
Host Organism: mouse
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DMABT-H14015, RRID:AB_11404487) Copy
Discontinued
http://antibodyregistry.org/AB_11404500
Comments: Discontinued: 2015; Discontinued on 27 July 2015; Flow Cyt,FuncS
Host Organism: mouse
Clonality monoclonal
Target(s): IGF1R
Proper citation: (Creative Biomart Cat# DMABT-H22487, RRID:AB_11404500) Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.