Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: DOT1L
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag: MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. DOT1L:JMC107-B04:C239899. SGC link: http://www.thesgc.org/structures/6CKO/
Proper citation: RRID:Addgene_119962 Copy
Species: Homo sapiens
Genetic Insert: GID4
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. GID4:JMC130-A03:C240642. SGC link: http://www.thesgc.org/structures/6CCR/
Proper citation: RRID:Addgene_119960 Copy
Species: Homo sapiens
Genetic Insert: GID4
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. GID4:JMC130-A04:C240838.
SGC links:
https://www.thesgc.org/structures/6CDG/
https://www.thesgc.org/structures/6WZZ/
https://www.thesgc.org/structures/7S12/
https://www.thesgc.org/structures/7SLZ/
Proper citation: RRID:Addgene_119961 Copy
Species: Homo sapiens
Genetic Insert: LOC149281
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag: MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. LOC149281:JMC119-E02:C237152. SGC link: http://www.thesgc.org/structures/6DUB/
Proper citation: RRID:Addgene_119967 Copy
Species: Homo sapiens
Genetic Insert: FBXL19
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. FBXL19:JMC067-G03:C226959. SGC link: http://www.thesgc.org/structures/6ASB/
Proper citation: RRID:Addgene_119954 Copy
Species: Homo sapiens
Genetic Insert: MBD3
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26101); Vector Backbone:pET28GST-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPRGS. MBD3:JMC065-E03:C226116. SGC link: http://www.thesgc.org/structures/6CC8/
https://www.thesgc.org/structures/6CCG/
Proper citation: RRID:Addgene_119959 Copy
Species: Homo sapiens
Genetic Insert: L3MBTL1
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. L3MBTL1:APC053-A03:C30586. SGC link: http://www.thesgc.org/structures/6BYB/
Proper citation: RRID:Addgene_119957 Copy
Species: Homo sapiens
Genetic Insert: MBD2
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. MBD2:JMC01O-G01:C207125. SGC links: http://www.thesgc.org/structures/6C1A/
http://www.thesgc.org/structures/6C1T/
http://www.thesgc.org/structures/6C1V/
http://www.thesgc.org/structures/6CNP/
Proper citation: RRID:Addgene_119958 Copy
Species: Homo sapiens
Genetic Insert: Human histone H2B
Vector Backbone Description: Backbone Size:4733; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:9545195
Comments: Two sequence differences from consensus sequence (D26G and V119I) were detected in Addgene sequencing. This clone is as originally published and isolated.
Proper citation: RRID:Addgene_11680 Copy
Species: Magnaporthe oryzae
Genetic Insert: hH1
Vector Backbone Description: Backbone Marker:Naweed Lab; Backbone Size:7779; Vector Backbone:pFGL822; Vector Types:Fungal expression (in Magnaporthe oryzae); Bacterial Resistance:Kanamycin
Defining Citation: PMID:31363034
Proper citation: RRID:Addgene_116896 Copy
Species: HIV-1
Genetic Insert: synthetic Gag missing the p6 domain
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29972351
Proper citation: RRID:Addgene_116890 Copy
Species: Magnaporthe oryzae
Genetic Insert: Cenp C (partial)
Vector Backbone Description: Backbone Marker:Naweed Lab; Backbone Size:8251; Vector Backbone:pFGL821; Vector Types:Fungal expression (in Magnaporthe oryzae); Bacterial Resistance:Kanamycin
Defining Citation: PMID:31363034
Proper citation: RRID:Addgene_116897 Copy
Species: Magnaporthe oryzae
Genetic Insert: CenpA promoter region
Vector Backbone Description: Backbone Marker:Naweed Lab; Backbone Size:11398; Vector Backbone:pFGL125_TetGFP(Hyg); Vector Types:Fungal expression (in Magnaporthe oryzae); Bacterial Resistance:Kanamycin
Defining Citation: PMID:31363034
Proper citation: RRID:Addgene_116898 Copy
Species: Magnaporthe oryzae
Genetic Insert: Cenp C (partial)
Vector Backbone Description: Backbone Marker:Naweed Lab; Backbone Size:7779; Vector Backbone:pFGL822; Vector Types:Fungal expression (in Magnaporthe oryzae); Bacterial Resistance:Kanamycin
Defining Citation: PMID:31363034
Proper citation: RRID:Addgene_116899 Copy
Species: Homo sapiens
Genetic Insert: PLEKHA1
Vector Backbone Description: Vector Backbone:pPAmCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30591513
Comments: Please visit https://www.biorxiv.org/content/early/2018/09/06/410811 for bioRxiv preprint.
Proper citation: RRID:Addgene_116860 Copy
Species: Homo sapiens
Genetic Insert: PLEKHA1
Vector Backbone Description: Vector Backbone:pPAmCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30591513
Comments: Please visit https://www.biorxiv.org/content/early/2018/09/06/410811 for bioRxiv preprint.
Proper citation: RRID:Addgene_116861 Copy
Species: Homo sapiens
Genetic Insert: PLEKHA1
Vector Backbone Description: Vector Backbone:pmCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30591513
Comments: Please visit https://www.biorxiv.org/content/early/2018/09/06/410811 for bioRxiv preprint.
Proper citation: RRID:Addgene_116862 Copy
Species: Magnaporthe oryzae
Genetic Insert: TubA promoter
Vector Backbone Description: Backbone Marker:Naweed Lab; Backbone Size:11085; Vector Backbone:pFGL1259R; Vector Types:Fungal expression (in Magnaporthe oryzae); Bacterial Resistance:Kanamycin
Defining Citation: PMID:31363034
Proper citation: RRID:Addgene_116901 Copy
Species: Magnaporthe oryzae
Genetic Insert: Alp6 (partial ORF)
Vector Backbone Description: Backbone Marker:Naweed Lab; Backbone Size:8096; Vector Backbone:pFGL1269R; Vector Types:Fungal expression (in Magnaporthe oryzae); Bacterial Resistance:Kanamycin
Defining Citation: PMID:31363034
Proper citation: RRID:Addgene_116902 Copy
Species: Homo sapiens
Genetic Insert: INPP4B
Vector Backbone Description: Vector Backbone:pmCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30591513
Comments: Please visit https://www.biorxiv.org/content/early/2018/09/06/410811 for bioRxiv preprint.
Proper citation: RRID:Addgene_116865 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
